SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039798 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039798
Domain Number 1 Region: 106-531
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.11e-115
Family Reverse transcriptase 0.0000000123
Further Details:      
 
Domain Number 2 Region: 845-1004
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.33e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 3 Region: 585-727
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-26
Family Ribonuclease H 0.0032
Further Details:      
 
Domain Number 4 Region: 2-57
Classification Level Classification E-value
Superfamily Acid proteases 0.0000116
Family Retroviral protease (retropepsin) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039798   Gene: ENSMODG00000029698   Transcript: ENSMODT00000042903
Sequence length 1116
Comment pep:novel chromosome:BROADO5:5:87146109:87150820:1 gene:ENSMODG00000029698 transcript:ENSMODT00000042903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVSGITQRVKRLPPRMVSVGPLEVQHSFLLMPDSPLNLLGRDLLCKLRATITCSPDGSL
SLEVPEESLKLLPVLLSENQEAKEPSIFEIPKDIPESLWATSSSDVGLLKSAVPVQIKTK
SSPPPSIPQYPLSKEAIEGITPVINSLIEQGIIIPCKSEYNTPILPIKKPKKGPDGKHIY
RFVQDLRAVNNHVIKRHSVVSNIHTIISSIPSTATYFTVVDLCSAFFSIPIHENSRHIFA
FTWKGSQYTWCRLPQGYVESPSLFEQILSQDTDNITFKNSKLIKYVDDLLLASTDAETCQ
EDSKHLLLELHKRGHKISKDKVQWCLQKVEYLGFILTAGARYISPKRIENIQKLSAPTTK
KQLRAILGATGFCRQWIPCYGEITKPLIALTKDSVPEPLKLEPEHLSALTDLKKAIMSAP
ALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLRGVAA
TALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRC
STLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGI
RYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHS
VGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRAD
AAAKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSPEGKPLLP
RSFYNQICQSIHKNGHFGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHAYRGK
AFGGRPLAYTPFEHLQIDFITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFVAKILL
KEIIPRFGLPARIDSDRGSHFTDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKT
MIGKLCTETHLKWPEILPLALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLG
GDITIASYIQELQHKLRELHESGAAVQAGPLDFSLHDLNPGDKVYIKNFKRTGATEPSWE
GPFQILLTTPTSIKIGERDSWIHCSHVKKASSAETD
Download sequence
Identical sequences K7E1Z7
ENSMODP00000039798 ENSMODP00000039798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]