SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039799 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039799
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.3e-36
Family Retroviral integrase, catalytic domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039799   Gene: ENSMODG00000028401   Transcript: ENSMODT00000042904
Sequence length 255
Comment pep:novel chromosome:BROADO5:8:80129810:80130883:-1 gene:ENSMODG00000028401 transcript:ENSMODT00000042904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKAGQYKFCLVIVDQLTRWPEAFPTARATAAFVAKVLLKEIIPRFGLPARIDSDRGSHF
TDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMTGKLCMETHLKWPEILPLAL
FYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDITIASYIQELQHKLRELHE
SGAAVQAGPLDFSLHDLNPGDNVYIKNFQRTGATQPSWEGPFQILLTTPTSIKVGEKDSW
IHCSHVKRASSVETD
Download sequence
Identical sequences K7E1Z8
ENSMODP00000039799 ENSMODP00000039799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]