SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039820 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039820
Domain Number 1 Region: 216-641
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-115
Family Reverse transcriptase 0.0000000123
Further Details:      
 
Domain Number 2 Region: 955-1114
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.47e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 3 Region: 695-837
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-26
Family Ribonuclease H 0.0032
Further Details:      
 
Domain Number 4 Region: 68-167
Classification Level Classification E-value
Superfamily Acid proteases 1.65e-16
Family Retroviral protease (retropepsin) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039820   Gene: ENSMODG00000027428   Transcript: ENSMODT00000042925
Sequence length 1226
Comment pep:novel chromosome:BROADO5:7:16810375:16814907:-1 gene:ENSMODG00000027428 transcript:ENSMODT00000042925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVQKLLEVLMTLREVPFRGVPKEYPKHNDGARGGAGAQESEDTTFDFPDPDVLLPVVP
IHCPPHTNEPHVTLKVGNTYYDCLLDTGASWSVLKRTPDLQCYSIGSENVMGVSGITQRV
KRLPPRMVSVGPLEVQHSFLLMPDSPLNLLGRDLLCKLRATITCSPDGSLSLEVPEESLN
LLPVLLSENQEAKEPSIFEIPKDIPESLWATSSSDVGLLKSAVPVQIKTKSSPPPSIPQY
PLSKEAIEGITPVINSLIEQGIIIPCKSEYNTPILPIKKPKKGPDGKHIYRFVQDLRAVN
NHVIKRHSVVSNIHTIISSIPSTATYFTVVDLCSAFFSIPIHENSRHIFAFTWKGSQYTW
CRLPQGYVESPSLFEQILSQDTDNITFKNSKLIKYVDDLLLASTDAETCQEDSKHLLLEL
HKRGHKISKDKVQWCLQKVEYLGFILTAGARYISPKRIENIQKLSAPTTKKQLRAILGAT
GFCRQWIPCYGEITKPLIALTKDSVPEPLKLEPEHLSALTDLKKAIMSAPALGIPDYNKP
FTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLRGVAATALLVTKTVD
LVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLP
DLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSE
FATEWSASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGF
LTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEG
PGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQS
IHKNGHFGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHAYRGKAFGGRPLAYT
PFEHLQIDFITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFVAKILLKEIIPRFGLP
ARIDSDRGSHFTDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMIGKLCTETH
LKWPEILPLALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDITIASYIQ
ELQHKLRELHESGAAVQAGPLDFSLHDLNPGDKVYIKNFKRTGATQPSWEGPFQILLTTP
TSIKIGERDSWIHCSHVKKASSAETD
Download sequence
Identical sequences K7E219
ENSMODP00000039820 ENSMODP00000039820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]