SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039831 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039831
Domain Number 1 Region: 169-311
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.47e-27
Family Ribonuclease H 0.0038
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-18
Family Reverse transcriptase 0.0000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039831   Gene: ENSMODG00000029003   Transcript: ENSMODT00000042936
Sequence length 363
Comment pep:novel chromosome:BROADO5:1:225419698:225420936:1 gene:ENSMODG00000029003 transcript:ENSMODT00000042936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPALGIPDYKKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAHLDPVAAGAPPCLR
GVAATALLVTKTVDLVLGCPLTIMCPHEIEALLIKHRTQAFSDQRITRYEITLLNSENIT
LKCCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFM
RDGIHYTGAAVVSEFATEWSASLPSNISAQGAELIALTQACIIAKDKKSTIYMDSRYAFG
ICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGN
NRADAAAKLAAIEGPGLILTLTTTDDLNLSLSYNEKEVEKWKQNFKAKQTNGVWVLSEGK
PLL
Download sequence
Identical sequences K7E230
ENSMODP00000039831 ENSMODP00000039831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]