SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039841 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039841
Domain Number 1 Region: 169-311
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.07e-27
Family Ribonuclease H 0.0032
Further Details:      
 
Domain Number 2 Region: 429-529
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.67e-23
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 2-115
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.41e-18
Family Reverse transcriptase 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039841   Gene: ENSMODG00000027316   Transcript: ENSMODT00000042946
Sequence length 529
Comment pep:novel chromosome:BROADO5:8:106318757:106320745:-1 gene:ENSMODG00000027316 transcript:ENSMODT00000042946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQHPIAYYSAQLDPVAAGAPPCLR
GVAATALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRNEITLLNSENIT
LKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFM
RDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFG
ICHSVGVLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGN
DRADAAAKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGK
PLLPRSFYNQICQSIHKNGHFGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHV
YRGKAFGGRPLAYTPFEHLQIDFITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFVA
KILLKEIIPRFGLPARIDSDRGSHFTDSVLNQIYSCLGITPKFHVPYHP
Download sequence
Identical sequences K7E240
ENSMODP00000039841 ENSMODP00000039841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]