SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039903 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039903
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.07e-33
Family Retroviral integrase, catalytic domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039903   Gene: ENSMODG00000028991   Transcript: ENSMODT00000043007
Sequence length 255
Comment pep:novel chromosome:BROADO5:Un:30101347:30102377:1 gene:ENSMODG00000028991 transcript:ENSMODT00000043007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKAGRYKFCLVIVDQLTRWPEALPTTRATADFVAKILLKEIIPRFGLPARIDSYRGSHF
TDSVLNQIYSCLGITPKFHVPYYPQSSGQVERMNKELKTMIGKLCTETHLKWPEILPLAL
FYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGHITIASYIQELQHKLRELHE
SGAAVQAGPLDFSLHDLNPGDKVYIKNFKQTGATQPSWEGPFQILLTTPISIKIGERDSW
IHCSHVKKASSAETD
Download sequence
Identical sequences K7E2A2
ENSMODP00000039903 ENSMODP00000039903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]