SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039913 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039913
Domain Number 1 Region: 6-180
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-40
Family DBL homology domain (DH-domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039913   Gene: ENSMODG00000028409   Transcript: ENSMODT00000043017
Sequence length 249
Comment pep:novel chromosome:BROADO5:Un:96741932:96746956:1 gene:ENSMODG00000028409 transcript:ENSMODT00000043017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPGPFLQVDIERLFSNTQEIIQLHKGLWSSVMAPILDKARRTRTLLQPADLLKGFKMFG
SLFKPYIRYCMEEEGCMEYMRSLLRDSDLFRVYVTWAEKHQQCQRLKLSDMLAKPHQRLT
KYPLLLKSVLKKTDDPPTKEAIVTMISSVERFISHINSRMRQRQEQQRLAAIISRIDSYE
VVESSTDEVDKLLKEFLRFDLTAPILGTSPDDTRQLLLEGSLKMKEGKDSKVSSNSDPFP
IPMDIPTSL
Download sequence
Identical sequences K7E2B2
ENSMODP00000039913 ENSMODP00000039913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]