SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039924 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039924
Domain Number 1 Region: 106-531
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.23e-116
Family Reverse transcriptase 0.0000000123
Further Details:      
 
Domain Number 2 Region: 585-727
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.36e-27
Family Ribonuclease H 0.0032
Further Details:      
 
Domain Number 3 Region: 2-57
Classification Level Classification E-value
Superfamily Acid proteases 0.00000788
Family Retroviral protease (retropepsin) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039924   Gene: ENSMODG00000027448   Transcript: ENSMODT00000043027
Sequence length 801
Comment pep:novel chromosome:BROADO5:3:489793037:489795510:1 gene:ENSMODG00000027448 transcript:ENSMODT00000043027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVSGITQRVKRLPPRMVSVGPLEVQHSFLLMPDSPLNLLGRDLLCKLRATITCSPDGSL
SLEVPEESLKLLPVLLSENQDAKEPSIFEIPKDIPESLWATSSSDVGLLKSAVPVQIKTK
SSPPPSIPQYPLSKEAIEGITPVINSLIEQGIIIPCKSEYNTPILPIKKPKKGPDGKHIY
RFVQDLRAVNNHVIKRHSVVSNIHTIISSIPSTATYFTVVDLCSAFFSIPIHENSRHIFA
FTWKGSQYTWCRLPQGYVESPSLFEQILSQDTDNITFKNSKLIKYVDDLLLASTDAETCQ
EDSKHLLLELHKRGHKISKDKVQWCLQKVEYLGFILTAGARYISPKRIENIQKLSAPTTK
KQLRAILGATGFCRQWIPCYGEITKPLIALTKDSVPEPLKLEPEHLSALTDLKKAIMSAP
ALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLRGVAA
TALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRC
STLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGI
RYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHS
VGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRAD
AAAKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSPEGKPLLP
RSFYNQICQSIHKNGHFGTQG
Download sequence
Identical sequences K7E2C3
ENSMODP00000039924 ENSMODP00000039924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]