SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039944 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039944
Domain Number 1 Region: 183-342
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.99e-41
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000182
Family Ribonuclease H 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039944   Gene: ENSMODG00000029614   Transcript: ENSMODT00000043047
Sequence length 454
Comment pep:novel chromosome:BROADO5:6:265303992:265305837:-1 gene:ENSMODG00000029614 transcript:ENSMODT00000043047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLQRGFLTSAGKSIANAEIINEVLSALQLPEALAVVHCSAHTGGTDPVSRGNDRADAA
AKLAAIEGPELLLTLTTTDDSNLSLSYDEKEVEKWKQKFKAKQVNGVWVSSEGKPLLPRS
FYHQICQSVHNNGHFGTQGIVDSVKRVWIAPGITTIASKVCSSCPTCQAYNQHAFRGKAF
GGRPLAYTPFEHLQIDFITMPKAGQYKFCLVIVDQLTRWPEAFPTARATAAFVAKVLLKE
IIPRFGLPARIDSDRGSHFTDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMI
GKLCTETHLKWPEILPLALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGD
TTIASYIQELQHKLRELHESGAAVQARPLDFSLHNLNPGDNVYIKNFQRTGATQPSWEGP
FQILLTTPTSIKVGEKDSWIHCSHVKRASSVETD
Download sequence
Identical sequences K7E2E3
ENSMODP00000039944 ENSMODP00000039944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]