SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039973 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039973
Domain Number 1 Region: 346-505
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 86-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.91e-26
Family Ribonuclease H 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039973   Gene: ENSMODG00000028783   Transcript: ENSMODT00000043077
Sequence length 559
Comment pep:novel chromosome:BROADO5:5:234696894:234698618:1 gene:ENSMODG00000028783 transcript:ENSMODT00000043077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSGEPL
HNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASL
PSNISAQGAELIALKQACIIAKDKKATIYTDSGYAFGICHSVGMLWLQRGFLTSAGKSIA
NAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTT
TDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQSIHKNGHFGT
QGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHAYCGKAFGGRPLAYTPFEHLQIDF
ITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFVAKILLKEIIPRFGLPARIDSDRGS
HFTDSVLNEIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMIGKLCTETHLKWPEILPL
ALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDITIASYIQELQHKLREL
HESGAAVQAGTIRLFLCMT
Download sequence
Identical sequences K7E2H2
ENSMODP00000039973 ENSMODP00000039973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]