SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040080 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040080
Domain Number 1 Region: 133-295
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000379
Family Retroviral integrase, catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040080   Gene: ENSMODG00000029345   Transcript: ENSMODT00000043182
Sequence length 625
Comment pep:novel chromosome:BROADO5:3:519356019:519361939:-1 gene:ENSMODG00000029345 transcript:ENSMODT00000043182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLREHLQLRAQRASLGANSKVSCFSPGPNLMFTRPGKKWALVVFDRKDRLKLVKQAHITS
SGVHCSLPETKKKVSFSYYWPTLVRDVTQWVKQCSCLQKSRSERSLPIQGVTKSHRGKDP
LPVLQVESVTQAFEQVGMGVVGPLVETPNGFRFILLSVDAYSRWVEASPLKEQNPVEVAG
ALIPFLLRFGRPQLLVTTLRVPFVNQVNRSLRRQLQSLGVPLGKLDIVMSAFQPKINSIL
AMTSSCIRKTLWNLLKGDLEKWDRVLDRALFTLRTAVTKNKRRSPFQILYGRKPRAAQEV
PSHFDVVAADTVTGDLEASETRDPVPKPMERPKQDSMPEPTQQSTLQPTPQSTLQLTLQP
TPQSTLQPTQQSTQQPIQQSTQQPIQQSTQQPIQQSTLQPIQQSTLQPIQQSTQQPLQQS
IQQPIPQCPQQLRPELIQQSMLESMQQPILEPGQPSGSEPMGQLLHQPLPEPLYQHIWQP
MLLGSLQQPIQQPLHPLIQQPMPLPNQQPMQLPMQLPLQQPMQQSLPQPIQQLILQPIQQ
PMQQSMQQPIQQLILQPIQQLIHQPIQQPMPQVMAEPLPPPLPRVTECHVASNWCQQTAP
ALEAPWEKWEPGGGAFWTQWRDPGN
Download sequence
Identical sequences K7E2S9
ENSMODP00000040080 ENSMODP00000040080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]