SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040102 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040102
Domain Number 1 Region: 86-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.06e-27
Family Ribonuclease H 0.0055
Further Details:      
 
Domain Number 2 Region: 346-388
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000174
Family Retroviral integrase, catalytic domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040102   Gene: ENSMODG00000027949   Transcript: ENSMODT00000042254
Sequence length 389
Comment pep:novel chromosome:BROADO5:4:106839276:106840482:-1 gene:ENSMODG00000027949 transcript:ENSMODT00000042254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSGEPL
HNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASL
PSNISAQGAELIALKHACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIA
NAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIKGPGLILTLTT
TDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQSIHKNGHFGT
QGIVDSVKRAWIAPGITTIASKVCSSCPTCQAYNQHAFRGKAFGGRPLAYTPFEHLQIDF
ITMPKAGQYKFCLVIVDQLTRWPEAFPTA
Download sequence
Identical sequences K7E2V1
ENSMODP00000040102 ENSMODP00000040102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]