SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040130 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040130
Domain Number 1 Region: 278-437
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.95e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 18-160
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.58e-28
Family Ribonuclease H 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040130   Gene: ENSMODG00000027344   Transcript: ENSMODT00000043232
Sequence length 549
Comment pep:novel chromosome:BROADO5:X:25095918:25097747:1 gene:ENSMODG00000027344 transcript:ENSMODT00000043232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKLRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASLPSNISAQR
AELIALKQACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIANAEIINEV
LSALKLPKALAVVHCSAHTGGSDPVSRGNDRADATAKLAAIEGPGLILTLTTTDNLNLSL
SYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLSRSFYNQICHFIHKNGHFGTQGIVDSVK
RVWIAPGITTVASKVCSACPICQAYNQHAYRGKAFGGRPLAYTPFEHLQIDFITMPKAGR
YKFCLVIVDQLTRWPEAFPTTRATADFVAKILLKEIIPRFGLPARIDSDRGSHFTDSVLN
QIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMIGKLCTETHLKWPEILPLALFYLRSR
PRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDITIASYIQELQHKLRELHESGAAVQ
AGPLDFSLHDLNPGDKVYIKNFKRTGATAPSWEGPFQILLTTPTSIKIGERDSWIHCSHV
KKASSAETD
Download sequence
Identical sequences K7E2X9
ENSMODP00000040130 ENSMODP00000040130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]