SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040133 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040133
Domain Number 1 Region: 89-206
Classification Level Classification E-value
Superfamily BRCT domain 2.49e-26
Family DNA ligase 0.06
Further Details:      
 
Domain Number 2 Region: 873-993
Classification Level Classification E-value
Superfamily BRCT domain 2.91e-24
Family BRCT domain 0.042
Further Details:      
 
Domain Number 3 Region: 729-805
Classification Level Classification E-value
Superfamily BRCT domain 2.88e-17
Family DNA ligase 0.012
Further Details:      
 
Domain Number 4 Region: 634-731
Classification Level Classification E-value
Superfamily BRCT domain 6.28e-16
Family BRCT domain 0.056
Further Details:      
 
Domain Number 5 Region: 49-118
Classification Level Classification E-value
Superfamily BRCT domain 0.000000654
Family 53BP1 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040133   Gene: ENSMODG00000004929   Transcript: ENSMODT00000043235
Sequence length 1094
Comment pep:known_by_projection chromosome:BROADO5:8:220774820:220919265:-1 gene:ENSMODG00000004929 transcript:ENSMODT00000043235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRAATSTSEMAMEATRLWGTRWKVRTRRMVARTNKFHVKVATASKPSRVIQFLKAGKAK
EVSYNALASHIISEDGDNPEVGEAREVFDLPVVKPSWVILSVRCGALLPVNGFSPESCQI
FFGVTACLSQISSEDRSALWALITFYGGDCQLNLNKKCSHLIVPEPKGEKYECALKRESI
KIVTPDWVLDSISDKSKKEEAFYHPRLIIYEEEEEEEEEEEEEDEGENEEQDSQNEGSTD
EKLSSPTSSQEGSTLGDQPFSPKLNTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQI
AAAKRRLPQGKESGLINLCANVPPVPSNILPPDVRSNLMASGQGLQSSERPEMMATWSPA
VRTLRNITNSADIQQINRPSNVAHILQSLSAPTKNLEQQQHQTQQQHQTQQQQQQQQQQH
HPILHLQPQQLMQLQQQQQQQQQQQQQQQQQQQPPPQISQQPFPQQQPHQFSQPQQQVHQ
QHQFTQQQLPFPQQQLHPPQQLHRPQQQLQQFQQQHALQQQLHQLQQQQLQQQQLAQLQQ
QNLQQQQLQQQQQLQQQQQQQQQQQLQQQQLRLHQHQQQQQQQMQNQTAQHLSQTSQALQ
QQVPPQQPQHHQQQPQHHQLFGHDPALEIPEECFLLGCVFAIADYPEQMSDKQLLATWKR
IIQAHGGTVDPTFTSRCTHLLCESQVSSMYAQAVRERKRCVTAHWLNTVLKKKKMVPPHR
ALHFPVAFPPGGKPCSQHIISVTGFIDGDRDDLKLMAYLAGAKYTGYLCRSNTVLICKEP
SGLKYEKAKEWRIPCVNAQWLCDILLGNFEALRQVQCSRYTVFNLQDPFAPTQHLVLNLL
DAWRIPLKVSPELLMGMRLPPKLKQNEVANIQPSSKRARIEDIPPPTKKLTPELTPFVLF
TGFEPVQVQQYIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLE
ECFKCQKFVDEQNFMLRDAEAEVLFCFSLEESLKRAHVTPLFKAKYFYITPGICPSLSTM
KAIVECAGGKVLSKQPSFRKLMEYKQNKSLSEIILISCENDLHLCREYFARGIDVHNAEF
VLTGVLTQTLDYES
Download sequence
Identical sequences K7E2Y2
ENSMODP00000040133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]