SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040185 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040185
Domain Number 1 Region: 169-311
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.94e-27
Family Ribonuclease H 0.0037
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.86e-19
Family Reverse transcriptase 0.0000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040185   Gene: ENSMODG00000028780   Transcript: ENSMODT00000043287
Sequence length 332
Comment pep:novel chromosome:BROADO5:3:494686317:494687453:-1 gene:ENSMODG00000028780 transcript:ENSMODT00000043287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLR
GVAATALLVTKTIDLVLGCPLTIMCPHEIEALLKKHRTQAFSDQRITRYEITLLNSENIT
LKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFM
RDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIANDKKATIYTDSRYAFG
ICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGN
DRADAAAKLAAIEGPGLILTLTTTDNLNLSLS
Download sequence
Identical sequences K7E334
ENSMODP00000040185 ENSMODP00000040185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]