SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040237 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040237
Domain Number 1 Region: 90-515
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.65e-112
Family Reverse transcriptase 0.0000000172
Further Details:      
 
Domain Number 2 Region: 829-988
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.21e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 3 Region: 569-711
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.14e-25
Family Ribonuclease H 0.0038
Further Details:      
 
Domain Number 4 Region: 9-41
Classification Level Classification E-value
Superfamily Acid proteases 0.0000788
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040237   Gene: ENSMODG00000029740   Transcript: ENSMODT00000043340
Sequence length 1104
Comment pep:novel chromosome:BROADO5:2:144867028:144871169:-1 gene:ENSMODG00000029740 transcript:ENSMODT00000043340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVGPLEVQHSFLLMPDSPLNLLGRDLLCKLRATITCSPDGSLSLEVPEESLNLLPVLL
SENQEAKEPSIFEIPKDIPESRWATSSSDVGLLKSAVPVQIKTKSSPPPSIPQYPLSKEA
IEGITPVINSLIEQGIIIPCKSEYNTPILLIKKTKKGPDGKHIYRFVQDLRAVNNHVIKR
HSVVSNIHIIISSIPSTATYFTVVDLCSAFFSIPIHENSRHIFAFTWKGSQYTWCRLPQG
YVESLSLFEQILSQDTDNITFKNSKLIKYVDDLLLASTDAKTCQEDSKHLLLELHKRGHK
ISKDKVQWCLQKVEYLGFILTAGAHYISPKRIENIQKLSAPTTKKQLRAILGATGFCRQW
IPCYGEITKPLIALTKDSVPEPLKLEPEHLSALSDLKKAIMSAPALGIPDYNKPFTLYVH
ERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLRGVAATALLVTKTVDLVLGCP
LTIMCPHEIEALLVKHRKQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSG
EPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGDAVVSEFATEWS
ASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGK
SIANAEIINEVLSALKLPKVLAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILT
LTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSFEGKPLLPRSFYNQICQSIHKNGH
FGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHAYRGKAFGGRPLAYTPFEHLQ
IDFITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFVAKILLKEIIPRFGLPARIDSD
RGSHFTDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMIGKLCTETHLKWPEI
LPLALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDITIASYIQELQHKL
RELHESGAAVQAGPLDFSLHDLNPGDKVYIKNFKQTGATEPLWEGPFQILLTTPTSIKIG
ERDSWIHCSHLLLRLIDSILSYEL
Download sequence
Identical sequences K7E386
ENSMODP00000040237 ENSMODP00000040237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]