SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040281 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040281
Domain Number - Region: 118-154
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0327
Family Moesin tail domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040281   Gene: ENSMODG00000027386   Transcript: ENSMODT00000043385
Sequence length 168
Comment pep:known_by_projection chromosome:BROADO5:7:245001377:245030273:-1 gene:ENSMODG00000027386 transcript:ENSMODT00000043385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIVSESERICKRNFASGGGRRRGPWRHHVLTSLRERGCLGDRESRFRPRGAEVEIIYLLT
SISVSWESMDRHIPIHALPDEIQKMSRDETVCKYCGVSYLILHEFKLMEEKMKAMEADMK
FYQGSVDREKSLQERLKSLEQDFQNSKTNGEAQAERLEPVIHFYFSYK
Download sequence
Identical sequences K7E3C9
ENSMODP00000040281 ENSMODP00000040281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]