SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040339 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040339
Domain Number 1 Region: 51-476
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-115
Family Reverse transcriptase 0.0000000131
Further Details:      
 
Domain Number 2 Region: 531-589
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000019
Family Ribonuclease H 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040339   Gene: ENSMODG00000029390   Transcript: ENSMODT00000043445
Sequence length 593
Comment pep:novel chromosome:BROADO5:Un:89773347:89775129:-1 gene:ENSMODG00000029390 transcript:ENSMODT00000043445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDGSLSLEVPEESLKLLPVLLSENQDAKEPSIFEIPKDIPESLWATSSSDVGLLKSAVPV
QIKTKSSPPPSIPQYPLSKEAIEGITPVINSLIEQGIIIPCKSEYNTPILPIKKPKKGPD
GKHIYRFIQDLRAVNNHVIKRHSVVSNIHTIISSIPSTATYFTVVDLCSAFFSIPIHENS
RHIFAFTWKGSQYTWCRLPQGYVESPSLFEQILSQDTDNITFKNSKLIKYVDDLLLASTD
AETCQEDSKHLLLELHKRGHKISKDKVQWCLQKVEYLGFILTAGARYISPKRIENIQKLS
APTTKKQLRAILGATGFCRQWIPCYGEITKPLIALTRDVVPEPLKLEPEHLSALSELKKA
ILSAPALGIPNYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCL
RGVAATALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENI
TLKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNANLILFTDGSSF
MRDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKATIY
Download sequence
Identical sequences K7E3I7
ENSMODP00000040339 ENSMODP00000040339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]