SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040465 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040465
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.48e-22
Family Reverse transcriptase 0.0000394
Further Details:      
 
Domain Number 2 Region: 172-262
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000177
Family Ribonuclease H 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040465   Gene: ENSMODG00000029320   Transcript: ENSMODT00000043572
Sequence length 263
Comment pep:novel chromosome:BROADO5:6:112885599:112886727:1 gene:ENSMODG00000029320 transcript:ENSMODT00000043572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALSELKKAILSAPALGIPNYNKPFTLYVHERRGVASGVLTQTLGPSQCPVAYYSAQLD
PIASGAPPCLRGVAATALLVTKTVDLVLGCPLTIMCPHEVEALLLRQRTQAFSDQRITRY
EITLLNNENITLKRCSTLNPATLLPDLPTSGEPLHSCETLVSMAEKPRDDLLDTPLKNSD
LILFTDGSSLMRDGIRYSGAAVVSEFATEWSASLPSNISAQGAELIALKHACIIAKDKKA
TIYTDSRYAFGICHSVGMLWLQR
Download sequence
Identical sequences K7E3W3
ENSMODP00000040465 ENSMODP00000040465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]