SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040501 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040501
Domain Number 1 Region: 106-531
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.56e-116
Family Reverse transcriptase 0.0000000123
Further Details:      
 
Domain Number 2 Region: 585-726
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.16e-26
Family Ribonuclease H 0.004
Further Details:      
 
Domain Number 3 Region: 2-57
Classification Level Classification E-value
Superfamily Acid proteases 0.00000713
Family Retroviral protease (retropepsin) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040501   Gene: ENSMODG00000028686   Transcript: ENSMODT00000043607
Sequence length 734
Comment pep:novel chromosome:BROADO5:Un:87911717:87913958:1 gene:ENSMODG00000028686 transcript:ENSMODT00000043607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVSGITQRVKRLPPRMVSVGPLEVQHSFLLMPDSPLNLLGRDLLCKLRATITCSPDGSL
SLEVPEESLNLLPVLLSENQEAKEPSIFEIPKDIPESLWATSSSDVGLLKSAVPVQIKTK
SSPPPSIPQYPLSKEAIEGITPVINSLIEQGIIIPCKSEYNTPILPIKKPKKGPDGKHIY
RFVQDLRAVNNHVIKRHSVVSNIHTIISSIPSTATYFTVVDLCSAFFSIPIHENSRHIFA
FTWKGSQYTWCRLPQGYVESPSLFEQILSQDTDNITFKNSKLIKYVDDLLLASTDAETCQ
EDSKHLLLELHKRGHKISKDKVQWCLQKVEYLGFILTAGARYISPKRIENIQKLSAPTTK
KQLRAILGATGFCRQWIPCYGEITKPLIALTKDSVPEPLKLEPEHLSALTDLKKAIMSAP
ALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLRGVAA
TALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKHC
STLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGI
RYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHS
VGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRAD
AAAKLVAIEGPGLI
Download sequence
Identical sequences K7E3Z9
ENSMODP00000040501 ENSMODP00000040501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]