SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040531 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040531
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-35
Family Canonical RBD 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040531   Gene: ENSMODG00000011052   Transcript: ENSMODT00000043637
Sequence length 322
Comment pep:known_by_projection chromosome:BROADO5:4:368137112:368439135:-1 gene:ENSMODG00000011052 transcript:ENSMODT00000043637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDL
CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDL
KDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDRPGSR
RRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSHSRSKSRSRSKSRS
RGKKEKSRSPSKEGKSRSRSRSADKARGKSKDRAEEKIQNNEEDGKAKSRSASQDKSKSR
AEEKIQGHRKAELGLDPSTLYF
Download sequence
Identical sequences K7E429
ENSMODP00000040531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]