SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040626 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040626
Domain Number 1 Region: 702-897
Classification Level Classification E-value
Superfamily LigT-like 8.37e-22
Family 2'-5' RNA ligase LigT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040626   Gene: ENSMODG00000027341   Transcript: ENSMODT00000043733
Sequence length 991
Comment pep:novel chromosome:BROADO5:3:272019040:272114769:1 gene:ENSMODG00000027341 transcript:ENSMODT00000043733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKAENFVLPFVDVDIREIFEIAIKAGFKSQKKRKEFWRRQQSYQKSKEKEQECQEEVLT
EQAMMCLPKGNPTDQSSWSQDESPLTKAMQDQNHHDGLKVLKHQDHPQKEGIPQEMEARM
QQYQGQKVRIQDRVELGQQPYEGERDEKRRELCCLQDQVLTKVLRGHQKIYSKVYFIQQQ
GQGEADITMNEQENPNQQEKKVEGYPVLPDLCNAKEGSAKEAEIAKCPIQDTPRVTEKGN
QLNQIEVKLTQEESHHPGQSDIESEQIELCQESRLPENPHDSERLNETEPQVYDQDDLKT
KQQKQVEGQSREPFSFLEKEVVKVMRLWQQWEINEVVKVMQEHHCSQVEEMQKVILQQWT
EEEGSRGAKLQCGSRKKLGSLMQPQGRQIHEHSWGNWGQCQKKEEIIPLLPQQDGELSEV
LSTETQLGREDKETMQQQNPNKEWPIQENEASELSQKESQVDEEPKVFQLEQQEENITGL
TGISQILQVLKQQHQCQKEAILKVMRQQQTHQEEAIQKALGEQCQVQEVLKAMRQEWQSQ
MEAILETMELQEQFQAKAILKVMRQLGHQWKEDSRMIESDQDHHEKEMIKHGSKCQSTKE
LQDQREVDLKDPSDQHDNGAKEREQDQDQNLDRESITFKERTSQRGRLKHTQNNISKKTG
QQIQNKADQRQELGEEENDNKVAEQNQEEEKKSKKHKRDSPNYFVAIPITNDQILDKIED
VQEFIYSKEPELLKALIPVQTMHITIIVAHLRTKQDVQKAISALEESKVRVEELLEGRRL
NMTFHGIGQFSNQVIYVKMSGEQEQQLLSKIAEAVERSFQEMNIDITGSKDFRPHLTFLK
LSKAPALRRKGFRKIHSELYKEYEDYPFGTEIFSQIDLCSMHKKKQESGYYHCECTISVA
PGSTGETQKLPTEIEYLKELCVPISPDPCPEAKAEETKATECCRCISCIAEDDDKPTEYT
SSIRPGCETVDQKTGVSVLDEIFTIDAKVFL
Download sequence
Identical sequences K7E4C4
XP_007487749.1.35504 XP_007487750.1.35504 ENSMODP00000040626 ENSMODP00000040626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]