SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040636 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040636
Domain Number 1 Region: 111-264
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-33
Family Retroviral integrase, catalytic domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040636   Gene: ENSMODG00000028796   Transcript: ENSMODT00000043743
Sequence length 346
Comment pep:novel chromosome:BROADO5:4:426525521:426526561:1 gene:ENSMODG00000028796 transcript:ENSMODT00000043743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLSTIESDDLEKTYIDSEIQKWKEKFGARKEHDVWLKETGKPLLPKDLHTYLCQAIHTK
GHFGTQAVIYTVKRQWVAPGINTVANKICSSGSVCQKLDQGVFRQKGLGGRPLAYCPFES
LQIDYISMPKAGRYKFCLVIVDRLTKWPEAFPSNTNTASFVVKVSTKEIIPRFGVPLTID
SHKGSHFTQDILKRVYENLGITPKYHVPYHPQSSGQVERVNKKIKTMVGKLCAEPHLKWP
EILPIALFYLRTRPRADLHISSYEMLFGHAPIQAKTCKTVYTSLLGGDCQLASYLSAFLQ
RLKELHDMGVLIQTGPLDYSFHNYEPGDMVYVKKNLLKHQQHRKAD
Download sequence
Identical sequences K7E4D4
ENSMODP00000040636 ENSMODP00000040636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]