SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040686 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040686
Domain Number - Region: 371-404
Classification Level Classification E-value
Superfamily UBA-like 0.000112
Family UBA domain 0.036
Further Details:      
 
Domain Number - Region: 277-323
Classification Level Classification E-value
Superfamily UBA-like 0.00606
Family UBA domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040686   Gene: ENSMODG00000029751   Transcript: ENSMODT00000043792
Sequence length 406
Comment pep:known_by_projection chromosome:BROADO5:1:150940623:150970518:-1 gene:ENSMODG00000029751 transcript:ENSMODT00000043792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYLDGVPFRIPESIKVEWEPPTASNLCIPDCRELLLGTMHDFSLERKVLYWLESATRQE
MTSDNEAPGLATAPPCWLLLVDSLDTSSMAEAEHQDVRQKNSTLPGSWNCEEDGTEQEED
EGTSSTSEDDSGPKEMPFPSTPWSPRSFPEKSNESSPESPTLSHRRRSLDIFHNVKNELE
GVRRRLSLLVHPLSRVATPERRLATKSLTFYHHFRNNRTMTSTTPVLDMPPPSPPPVPPR
PSTAGSIPPIRSHKPTVPSLSPYSCLPPPPGTPRPLSSGNNHPDSTAELLSALSQEERDL
IEPVLALGYPLRRAILALQKTGRQSLSQFLSYLGTCDRLVKQGYSESLVEEAMEIFQYSE
SKASEFLHLWEQFSDMGFQQDRIKEVLLLHENHRERALEELMTRAQ
Download sequence
Identical sequences K7E4I4
ENSMODP00000040686 ENSMODP00000040686 XP_003340040.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]