SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040698 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040698
Domain Number 1 Region: 86-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-26
Family Ribonuclease H 0.0038
Further Details:      
 
Domain Number 2 Region: 346-388
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000174
Family Retroviral integrase, catalytic domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040698   Gene: ENSMODG00000027324   Transcript: ENSMODT00000043804
Sequence length 390
Comment pep:novel chromosome:BROADO5:1:81071485:81072758:1 gene:ENSMODG00000027324 transcript:ENSMODT00000043804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSGEPL
HNCETLVSMAEKPRDNLLDTPLDNADLILFADGSSFMRDGIRYTGAAIVSEFVTEWSASL
PSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIA
NAEIINEVLSALKLPKALAVVHCSAHTGDSDPVSRGNDRADAAAKLAAIEGPGLILTLTT
TDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQSVHNNGHFGT
QGIVDSVKRVWIAPGITTIASKVCSSCPTCQAYNQHAFRGKAFGGRPLAYTPFEHLQIDF
ITMPKAGQYKFCLVIVDQLTRWPEAFPTAQ
Download sequence
Identical sequences K7E4J6
ENSMODP00000040698 ENSMODP00000040698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]