SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040720 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040720
Domain Number 1 Region: 143-256
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.41e-21
Family Retrovirus capsid protein, N-terminal core domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040720   Gene: ENSMODG00000029554   Transcript: ENSMODT00000043826
Sequence length 402
Comment pep:novel chromosome:BROADO5:7:16814966:16816649:-1 gene:ENSMODG00000029554 transcript:ENSMODT00000043826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMEDKIGKIEDKMQAQLEDLKCFLQDQWANTHSTRNRPVSEPLNEEISFPEIEMENTF
PIAQLTDCFSRAVQILSEFNPQNPSPAIPASHVPSPTENQITMQGRSCPPRETCPCQTDP
QVQNSTRGLFPLREVPEIGRNGDVVTLRHRIPFTPQEINEFTRNIPTYEQDPFLVTKKMG
DIFFQYNPSYKDVESLLQAFLSEREKNKIIAHVNKTRGRNAAHWPSQDPEWDYNNPEDYL
QLYRCREAILTAMKECADSTDKWMELEKIKQKENETPSRFMDRIIEFGNRYLDWDLNKEN
SLRQVRRIFVNNSCKVIKNYFKTQCPRWSDMDLEELRKTAIYVFKGNEEKEKENNDDMEE
MKKKMRCVIDRITKLESGHDNEPTTIAPLQKIQLSIHYLPLL
Download sequence
Identical sequences K7E4L8
ENSMODP00000040720 ENSMODP00000040720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]