SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040735 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040735
Domain Number 1 Region: 784-852
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000424
Family IBR domain 0.0000208
Further Details:      
 
Domain Number 2 Region: 75-169
Classification Level Classification E-value
Superfamily PUG domain-like 0.00000000000327
Family PUG domain 0.0045
Further Details:      
 
Domain Number 3 Region: 701-766
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000441
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 4 Region: 864-914
Classification Level Classification E-value
Superfamily RING/U-box 0.000000127
Family RING finger domain, C3HC4 0.031
Further Details:      
 
Domain Number 5 Region: 357-384
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000667
Family Ran binding protein zinc finger-like 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040735
Domain Number - Region: 409-431
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000863
Family Ran binding protein zinc finger-like 0.0045
Further Details:      
 
Domain Number - Region: 311-336
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000902
Family Ran binding protein zinc finger-like 0.0033
Further Details:      
 
Domain Number - Region: 580-618
Classification Level Classification E-value
Superfamily UBA-like 0.00481
Family UBA domain 0.014
Further Details:      
 
Domain Number - Region: 217-250
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0387
Family TFIIH p44 subunit cysteine-rich domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040735   Gene: ENSMODG00000003397   Transcript: ENSMODT00000043842
Sequence length 933
Comment pep:novel chromosome:BROADO5:1:173493075:173499331:1 gene:ENSMODG00000003397 transcript:ENSMODT00000043842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEGLQEEERVFLAAREELVSALRKDPGQSFSPEQLHRLLDNPLPLATRYPKLNASQLV
QSNAQGGEPRDYLQNLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGR
EVLRLYGYTEEQPDGLSFPEGQEEPDGHRVATVTMDVLLLRTELTLLLENSHPRSEALEQ
LLKEGSNGEMLPFSESVSPLRETTSNSLPAPQTQGTTSGSCFLCGSVPGTLHCPTCGHAL
CPACDCLFHRHPSRAHHLRQPVPGNHPASNLSSSLSNLALPRPLLTSPPTFGDSSLPSWS
SPTPEPPSTRPPWHCAACAMLNEARAVLCVACDRPRGCKGVGQGIENPRAGIGGGPHRGR
WSCQSCTFENEPATVLCAICERPRLAQPPSLVGDVRDTGACLPALEAGDWHCVHCTFRNS
GPGWVCTMCNRTSSPTPPLLPSWIPNSLGEGARTSVCLKPVSAHQISTPSASLHALRGDL
EQQRQDKMREDGLRLVAMIRAGEAEGACPEEVFSALQYSGTEVPLQWLRSELPYVLEMVA
EMAGRQDPSLGAFSCQEAKQAWLIRHGNLDEAVEECVRARRRKVRELEILGFGPEEGTLQ
ALYQHGGDVGRALTELQRHRLEPFHQRLWEAPEPNPSWDGPDKQSLIRRLLAIYALPSWG
RAELALSLLQETPRNYELMDVVEAVRHSPDRAFLRRLLAQECAVCGWALPRNRMQALTSC
ECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDETQLVSYFSTLDIQLRESLNPDA
YALFHKKLTERVLMRDPKFLWCTQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHQ
GRSCEDFQSWKRANDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQF
CSGCYSAFYAKNVCLRWKEGGSRLGGGTQSDYT
Download sequence
Identical sequences K7E4N3
ENSMODP00000040735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]