SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040977 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040977
Domain Number 1 Region: 286-718
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000159
Family Hermes transposase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040977   Gene: ENSMODG00000027514   Transcript: ENSMODT00000044087
Sequence length 766
Comment pep:known_by_projection chromosome:BROADO5:7:242878049:242883199:1 gene:ENSMODG00000027514 transcript:ENSMODT00000044087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKRGVVGRVEAHPQPGSSCFLSFLSPGGWVWRFWIPSGRDSEIPKMPKRRSDLFSFLNV
KKVKMGAEQEMNENHGGAWQPKDPRAEPITGEKPSCSSKEAVDHLVLPDCWSKKQALLFT
DQYKWLEIKEGKLGCKDCSTVQHLGARAEKHVHVSKEWIAYLVTPNGSNKITRQASLRKK
MREHDVSKAHNTIQDLIKGPTSSDPVSSSAPKLSIKNIDATVKVFNTVYSLVKCNRPLSD
IEGVIELQEEKGEDIGSCLHTRYSATRIAEHIAKEMKMRIFRDIIEKNAKICVVIDETSA
VSKKSTLVIYLQCTVQSAPSPVMLFVALKELMSMTADCIFSTLLSALNDCGFNNDYLNDN
LIAFCSDGANSVLGRKSGVALKLLENFPKIILWHCLNHRLQLSLDDSISEIEQVNHLKMF
LDKTYSIYHLSNTSHTELETIAKELELEIIKIGRVLGPRWAACSLRVATAVWRSYPALYV
SFSQSSSYSGLAKRLANINFLKDLALTMDILEEFSLLSTALQSRSTNIQKAQKLIQCTIK
ALENLKTRPGKYESQIEDLIKSNEFKDIPFNKNNKFNTLPRNLLLEKIIQHMHLRLLLEG
NDDEGILSYFNLLEPSTWPYEELTLPWIAGERKLDHLSEILKYEIDLNDFRDFVDNNVKS
KKAPIPTTIQEAQKIVRTIAVGSAEVERGFGLMNVICTRVRSSLKVDHISDFMTINLLGK
ELADWDATPYVKSWMNCHHRLATDTRVRKKATRAFYEDRLALWNLR
Download sequence
Identical sequences K7E5C5
ENSMODP00000040977 ENSMODP00000040977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]