SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040986 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040986
Domain Number 1 Region: 4-253
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.11e-60
Family Reverse transcriptase 0.00000181
Further Details:      
 
Domain Number 2 Region: 297-364
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000164
Family Ribonuclease H 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040986   Gene: ENSMODG00000027727   Transcript: ENSMODT00000044096
Sequence length 368
Comment pep:novel chromosome:BROADO5:3:521703429:521704533:1 gene:ENSMODG00000027727 transcript:ENSMODT00000044096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSKLIKYIDDLLLASADAEVCQEDIKHLLLELHNRGHKISKDKVQWCLPKVEYLGFILTA
GARSISPKRIENIQKLSAPTTKKLLRAILGATGFCRQWIPCYGEITKPLIALTRDSVPKP
LKLEPEHLSALSELKRAILSAPALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPVA
YYSAQLDPIASGAPKCLRGMAATPLLVTKTVDLVLGCPLTIMCPHEVEALLLRQRTQAFS
DQRITRYEITLLNNENITLKRCTTLNPATLLPDLPSGEPLHSCETLVSVVEMPWDDLLET
PLKNSDLILFTDGSSFMRDGIRYTGAAVVTEFATESSASLSSNISAQGAELIALKHACII
AKGKRATI
Download sequence
Identical sequences K7E5D4
ENSMODP00000040986 ENSMODP00000040986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]