SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041019 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041019
Domain Number 1 Region: 17-96
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.12e-18
Family Canonical RBD 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041019   Gene: ENSMODG00000029239   Transcript: ENSMODT00000044129
Sequence length 103
Comment pep:novel chromosome:BROADO5:3:146772710:147149330:-1 gene:ENSMODG00000029239 transcript:ENSMODT00000044129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTGLKQRETTMTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKGDIEAIFAKYGKIV
GCSVHKGYAFVQYMSERHARAAVAGENARIIAGQPLGKLTLHY
Download sequence
Identical sequences K7E5G7
ENSMODP00000041019 ENSMODP00000041019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]