SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041052 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041052
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.97e-26
Family Ribonuclease H 0.0046
Further Details:      
 
Domain Number 2 Region: 263-336
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000253
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041052   Gene: ENSMODG00000027975   Transcript: ENSMODT00000044162
Sequence length 336
Comment pep:known chromosome:BROADO5:8:80146191:80147237:-1 gene:ENSMODG00000027975 transcript:ENSMODT00000044162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPQGRRAGAAVVDHTGQVIWDASLPEGTSAQKAELVALAAALRVAKDKRVTIYTDSRYA
FATLHVHAPIYQERGFVTSAGKSVAHLEDIQDLLAAVWEPRAVAIVHTPGHQSGSSLPAM
GNRWADEAAKAATTQDRAHTLVLPIQANPEPLGPPSLIPNPPPDPSQYSDSGHRWIKGKE
GHPVGSFFQDPAGNLLLPRIAGQLLTTHLHHLTHLGANKLHELLQKGRIRFQDSQSFLTE
LVDKCTACQPTRPANPNSHFGTHLRGTRPCEHWELDFTEVRPGKFGFWYLLVLVDTFTGW
PEAFATKAETAQAVAKILLEEIIPRFGVPSSLGSDN
Download sequence
Identical sequences K7E5K0
ENSMODP00000041052 ENSMODP00000041052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]