SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041193 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041193
Domain Number 1 Region: 399-488
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000331
Family Tudor domain 0.0053
Further Details:      
 
Domain Number 2 Region: 60-216
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000783
Family Extended AAA-ATPase domain 0.077
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000041193
Domain Number - Region: 245-293
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000193
Family Canonical RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041193   Gene: ENSMODG00000013609   Transcript: ENSMODT00000044302
Sequence length 859
Comment pep:known_by_projection chromosome:BROADO5:1:311408236:311498597:-1 gene:ENSMODG00000013609 transcript:ENSMODT00000044302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRCPLGSTILKVKLLDMGEPRALLATALSPPSLGDIERTILLLKEVGALAVSGQREEEN
PHDGELTFLGRVLAQLPVDQQLGKLIVLGHVFGCLEECLIIAAALSLKNFFAMPFRQHLD
GYRNKMNFSGNSKSDCIALVEAFKTWQACRQRGEFRHPKDELDWGRLNYIQIKRIREVAE
LYEELKNRITQFNMCVDTQRPVMDHEYVYKQRFILQVVLAGAFYPNYFTFGQPDEEMAIR
ELAGKDPKTTVVLKHIPPYGFIYYKQLQSLFRQCGQVKSIVFDGTKAFVEFSRNPTERFK
TLPAVYMAIKMSQLKVPLELSVHAGEEIEGKVQGGTVTKLRNTRVNVDFQKQTIDTMQIS
LDALEQSQAITSLLLTIDVTEVVEVGHFWGYRIDEKNTNILKKLTVEINQLKLVPLPIRP
YPDLVCLAPFANLNKETYFRAQILYVSGNSAEVFFVDYGNRSHVSLDLLMEIPCHLLELP
FQALEFKICKMRPSAKSLVCGEHWSYGASQRFAALVNGCALIVKVYSVVHSVLHVDVYRY
SGIKEVVNIRDVLIKECYAELAEESYESKQSNEMLKEFFSKSVENGASATIPPSAHSKED
EKFLIRILLDSFSANKLGAPNCKVLLHGPFNPYELKCHSMTRISKFRCVWIEKESINSVI
ISDAPEDLHQRMLVAASLSVNATGSTMLLRETSLMPHIPGLPALLSMLFAPVMELRVDQS
GKCYTGALCGLGWNPTTGTPILPEHDIELAFDVQLNVEDIVEINILRAAINKIVCDGPNG
CMYLGPERIAQLQDNARQKLLGLFCKLKPREIIVPTWYEKTYDWNQVDPKLIMEQSDRDS
GRGKYTFLYQLHKLIVLST
Download sequence
Identical sequences K7E5Z1
ENSMODP00000041193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]