SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041237 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041237
Domain Number 1 Region: 346-505
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 86-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.78e-27
Family Ribonuclease H 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041237   Gene: ENSMODG00000028121   Transcript: ENSMODT00000044346
Sequence length 617
Comment pep:novel chromosome:BROADO5:4:201033298:201035923:-1 gene:ENSMODG00000028121 transcript:ENSMODT00000044346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENSTLKRCSTLNPATLLPDLPTSGEPL
HNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASL
PSNISAQGAELIALKHACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIA
NAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTT
TDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQSIHKNGHFGT
QGIVDSVKRVWIAPGITTIASKVCSSCPTCQAYNQHAFRGKAFGGRPLAYTPFEHLQIDF
ITMPKAGQYKFCLVIVDQLTRWPEAFPTARATAAFVAKVLLKEIIPRFGLPARIDSDRGS
HFTDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMIGKLCTETHLKWPEILPL
ALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDTTIASYIQELQHKLREL
HESGAAVQAGPLDFSLHDLNPGDNVYIKNFKRTGATEPSWEGPFQILLTTPTSIKVGEKD
SWIHCSHVKRASSVETD
Download sequence
Identical sequences K7E635
ENSMODP00000041237 ENSMODP00000041237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]