SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041250 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041250
Domain Number 1 Region: 86-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-27
Family Ribonuclease H 0.0052
Further Details:      
 
Domain Number 2 Region: 346-398
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000138
Family Retroviral integrase, catalytic domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041250   Gene: ENSMODG00000028728   Transcript: ENSMODT00000044358
Sequence length 399
Comment pep:novel chromosome:BROADO5:7:230079421:230080811:1 gene:ENSMODG00000028728 transcript:ENSMODT00000044358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSGEPL
HNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASL
PSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIA
NAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTT
TDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQSIHKNGHFGT
QGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHAYRGKAFGGRPLAYTPFEHLQIDF
ITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFVAKI
Download sequence
Identical sequences K7E648
ENSMODP00000041250 ENSMODP00000041250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]