SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000486 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000486
Domain Number 1 Region: 206-238
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000262
Family CCCH zinc finger 0.00024
Further Details:      
 
Domain Number 2 Region: 166-201
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000379
Family CCCH zinc finger 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000486
Domain Number - Region: 230-258
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.085
Family Obg GTP-binding protein N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000486   Gene: ENSMODG00000000407   Transcript: ENSMODT00000000498
Sequence length 424
Comment pep:known_by_projection chromosome:BROADO5:1:655753032:655755267:1 gene:ENSMODG00000000407 transcript:ENSMODT00000000498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASATLTGPRNMSTTLLSAFYDIDFFCKTEKSLTNLNLNSMLDKKAVGTPVTTSPSSSFTP
GFLRRHSTSNLQALTHPNPSPATVPGNCSPKFTGVNSCSSSGGSSSYSNLKEPSGGGGSA
GTTALLNKENKFRDRSFSENGDRSQHLMQLQQQQQQQKSGGGSQINSTRYKTELCRPFEE
SGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRPS
PSGGAGGSGGDLRAFSPREALHLGFAAHPREPRPKLHHSLSFSGFSSAHHQHPGGLESPL
LESPTSCAAAAAALLYGAGGGGEDLLSPAPCAACANNAFAPFSGQELSNLITPLAIHTHN
FAPLRRLSESPVFDAPPSPPDSLSDRESYLSGSLSSGSLSGSESPSLDSGRRLPIFSRLS
ISDD
Download sequence
Identical sequences F6QMJ3
13616.ENSMODP00000000486 ENSMODP00000000486 ENSMODP00000000486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]