SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000617 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000617
Domain Number 1 Region: 607-672,710-808
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-32
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 2 Region: 814-937
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-20
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 1226-1359
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-19
Family Second domain of FERM 0.0052
Further Details:      
 
Domain Number 4 Region: 1128-1207
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000455
Family First domain of FERM 0.087
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000617
Domain Number - Region: 26-120,715-735
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000617
Family BAR domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000617   Gene: ENSMODG00000000515   Transcript: ENSMODT00000000632
Sequence length 1503
Comment pep:known_by_projection chromosome:BROADO5:1:655142807:655254840:-1 gene:ENSMODG00000000515 transcript:ENSMODT00000000632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELLEAEGTVDWKERCIALESQLMKFRLQASKIRELLAEKMQQLERQVIDSDRQAERAF
QQVQVMEEKLKAANIQTSEAETRLYKKCQDLETLLQEKDDIIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTVKLQELELENQNLRLINQNQTEEIRTIQVKLQEVQGKKLSTASTP
KPSEGQRLSSLTFGCFLSRAKSPQQVIKSEEVSKISSKELEFPEGNHVEEMDIPDTSLGS
QVQEHNKGRRSLQQNSCVLEQNGATKTSYTLQSGDGIKDTSKNSCVTVSDWSSDEEEESK
ERLKSRCDSTLSSHTSEESTRYSRMGSEMYLTASDDSSSLFEEESFGIKRTEHKKLYSWQ
QEAQWKAQNSISGKGNCESRSKKGKDGFSDELNKKFQCQRLDYSSSSSEANSPSPILTPA
LAPKNPSLLPTGHQHPMAFHPSSNLPSAKLRIPNVFSISVALAKRHLSQPQLSSDRMFGR
NRNAISMIRPLKPQETDIDLVDGDSMEMVENMDVGYDDGVFSYDTLEVSCLEDSEMCDSA
AKKAAGGKPPTPPLHRFPSWESRIYAVAKSGIRMSEVFNTDNIHKNSLLMTSYSTSGLYT
SLIYKDMTTPVYTTLKGKATQISNSPFLDDSSGSEEEDSSRSSSRTSESDSRSRSGPGSP
RALKRGVSLSSVTSESDYAIPPDAYSTDTEYSEPEQKLPKTCSSSGDNGKNEPLEKSGYL
LKMGGKVKTWKRRWFVLKGGELLYYKSPSDVIRKPQGHIELSMSSHIIRGDNKQTVQLTT
EKRTYYLTADSPNILEEWIKVLQNVLRIQAANPLFLQPDGKPTVKGLLTKVKHGYSKRVW
CTLIGKTLYYFRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIH
PKEQGPTYLLIGSKHEKDTWLYHLTVAAGSTNANVGSEFEQLVCKLLNIEGEPTSQIWRH
PTLCHSKEGISSPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQIC
LTHPELQNEICCQLIKQTRRRQVQNQPGPLQGWQLLALCVGLFLPQHPFLWLLKLHLKRN
ADSKTEFGKYAIYCQRCVERAQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNG
IYQVVGFDASTTVEEFLNTLNQETGMRKPAQSGFALFTDDPSGKDLEHCLQGNIKICDII
SKWEQASKEQQPGKCEGTRTVRLTYKNRLYFSVQVRGESEREKLLLMYQTNDQIVNGLFP
LNKELAIEMAALLAQVEIGDFERPFSTPAGQVTSQCKANQTLKQVIEKFYPKRYRNGCSE
EQLRQLCQRLSTRWMALRGHNAADCVRIYLTVARKWAFFGAKLYLAKPVTPSTLGNTFIW
LAVHEDGISILEYNSMRLIVTYVYKSLMTFGGYQDDFMVVINSTHSKDKPTDKFLFTMAK
PKILEITLLVASYINNFHQQKAALHHLSAPALLSARKGGAKNKDMGSQPLLLNSRPTKGP
TLL
Download sequence
Identical sequences F6Y5I6
ENSMODP00000000617 XP_001382194.2.35504 ENSMODP00000000617 13616.ENSMODP00000000617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]