SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000830 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000830
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-17
Family V set domains (antibody variable domain-like) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000830   Gene: ENSMODG00000000694   Transcript: ENSMODT00000000848
Sequence length 87
Comment pep:known_by_projection chromosome:BROADO5:8:205073652:205073912:1 gene:ENSMODG00000000694 transcript:ENSMODT00000000848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLDAGITQTPWHVITRAGQNTDLRCEQNLGHNTLYWYQQDSKMGLRMMFYYNNKALIEKA
NISNRFKPNSPENSRLNLHIESLQAED
Download sequence
Identical sequences F6WLW5
ENSMODP00000000830 ENSMODP00000000830 13616.ENSMODP00000000830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]