SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000848 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000848
Domain Number 1 Region: 527-781
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-74
Family Protein kinases, catalytic subunit 0.00000000059
Further Details:      
 
Domain Number 2 Region: 991-1128
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.09e-59
Family FAT domain of focal adhesion kinase 0.000000174
Further Details:      
 
Domain Number 3 Region: 176-297
Classification Level Classification E-value
Superfamily Second domain of FERM 4.71e-40
Family Second domain of FERM 0.000000401
Further Details:      
 
Domain Number 4 Region: 75-174
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.71e-40
Family First domain of FERM 0.00000219
Further Details:      
 
Domain Number 5 Region: 298-406
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-37
Family Third domain of FERM 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000848   Gene: ENSMODG00000000707   Transcript: ENSMODT00000000866
Sequence length 1135
Comment pep:known_by_projection chromosome:BROADO5:3:423555022:423862863:-1 gene:ENSMODG00000000707 transcript:ENSMODT00000000866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLELGGQPALKPAGAIYMEKSGCSPFPICWAKEYDRYLASSKTMAAAYLDPNLNHAPTS
STKTHLSTGMERSPGAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLESVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGSNPTHLADFNQVQTIQYSNSDDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANNEKQGVRTHTVSVSVSHCQHKVKKTKRFLPLVFCSHEPPPTDEISGDETDDYAEIIDE
EDTYTMPSKSYGIDEEDVAQRDSGISLGISKVEGSFASWRKKVFYSPENPAMAVAIKTCK
NCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYS
LDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSADCVKLGDFGLSRYMEDSTYY
KASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIEN
GERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQQEERMRMESRR
QVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQANHYQVSGYPGSHGITAMA
GSIYPGQASLLDQTESWNHRPQEVSMWQPNMEDSTTLDMRGLSQVLPAHLMEERLIRQQQ
EMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPTGNQHIYQPVGKPDHAAPPKKPP
RPGAPSHLGSLASLSSPVDSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIE
MSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGEL
INKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQARPH
Download sequence
Identical sequences F6WLE6
ENSMODP00000000848 ENSMODP00000000848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]