SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000959 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000959
Domain Number 1 Region: 112-229
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.51e-34
Family Canonical RBD 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000959   Gene: ENSMODG00000000807   Transcript: ENSMODT00000000978
Sequence length 282
Comment pep:known_by_projection chromosome:BROADO5:8:300227620:300260954:1 gene:ENSMODG00000000807 transcript:ENSMODT00000000978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVEENNFEGRESRSQSKSPAGSPARVKSESRSGSRSPSRASKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYER
GYDRGYDRYEEYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
Download sequence
Identical sequences F6SRR9
ENSMODP00000000959 XP_007505424.1.35504 ENSMODP00000000959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]