SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001394 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001394
Domain Number 1 Region: 229-328
Classification Level Classification E-value
Superfamily Fibronectin type III 3.77e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 427-534
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000581
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 3 Region: 529-628
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000769
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 656-820
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000136
Family Fibronectin type III 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001394
Domain Number - Region: 328-411
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0959
Family V set domains (antibody variable domain-like) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001394   Gene: ENSMODG00000001161   Transcript: ENSMODT00000001422
Sequence length 894
Comment pep:known_by_projection chromosome:BROADO5:2:25708850:25781451:-1 gene:ENSMODG00000001161 transcript:ENSMODT00000001422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFLKFLVASLQWDFIRMIIADDTAYQIPPWNFTLSCFLPNKTDEFHWPSGAPKTSSVSD
EDHQSTDTSFNLHDSHPSTESFYCCLWSEHDKNPSMCANSTERKTFVSPTAHSLAWTQRG
SVSWSIQCWVKMDLKILICDLESSFKNSAETLKFQAHLSYVLSEASQEDSPMVSQKGDFQ
VVQCNCSRSEDCECQVPMPIAKLSSTSLMYLEITNGVLFLQSPLMSVKLINIVKPDPPLR
LLMEITDDGKLKISWSSPPLTPYQLQYEVKYSVKSTETRAQIAEIVLDTFLLVGNVLPGS
SYTAQVRGKRLDGPGAWSDWSTPSNFTTPEVIYFPPKILTSVGSNASFYCIYKHRNTIVP
SKNVFWWLNLAEKIPPSHYDVMNAHVSRVTLLNMNATKPRGKYAYDAVYCCQENECHHRY
AELYVIDVNINISCETDGYLTKMTCRWPANTVASLAGSMLQLRYFRSSLYCSDFPTTHHA
SDPKDCHLQMDGFYECTFQPIFLLSGYTMWIHISHSLGSLESPPTCVVPDSVVKPLPPSR
VNAEVMAKTGLLNVSWRKPDLPENKLQFQIRYAVNDHGELWKLHQAYGSESTSASFQVLD
FCSVYIAQVRCKRLDGLGYWSNWSNPAYTVVMDIKAPTRGPEFWGIVHEDPMGKERNITL
FWKPLGKNHSLCSVRRYIVKHYTESNKTWAEDTGNATKVTFPWTELAHTVTVVAVNSIGP
SIVNFNLTFSWHMSTVNSVQSLSVHAVNSSCVVLSWIIEPTEYTLMYFVIEWKNLDEENG
IKWIRVSSNVKKYYIRDHFIPIEKYQFSLYPVFLEGVGKPVMTNTIPREDTMKQENDPGL
YVIIPIVISSSVLLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGVNFHKRVDVL
Download sequence
Identical sequences F7CJR8
ENSMODP00000001394 ENSMODP00000001394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]