SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002111 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002111
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-22
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 2 Region: 236-339
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.31e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002111   Gene: ENSMODG00000001723   Transcript: ENSMODT00000002154
Sequence length 345
Comment pep:known_by_projection chromosome:BROADO5:5:118959562:119227456:1 gene:ENSMODG00000001723 transcript:ENSMODT00000002154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLIGVLLLTSALASQRYGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVNTNGSIHS
PKFPHTYPRNTVLVWRLVTAEENMWIQLTFDERFGLEDPEDDICKYDFVEIEEPSDGTIL
GRWCGSSTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYTLLTPHHTETLSPSVLPPSA
LPLDLLNNAIAAFGTLEELIRYLEPDRWQLDLEDLYRPTWQLLGKAYVLGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSLREELKRTDTIFWPGCLLVKRCGGNCACCQYNCNECQCIPSK
VTKKYHEVLQLKPRIGIKGLHKSLTDVLLEHHEECDCVCKGNTEG
Download sequence
Identical sequences F6XG94
ENSMODP00000002111 ENSMODP00000002111 XP_001375171.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]