SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002873 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002873
Domain Number 1 Region: 4011-4055
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000148
Family RING finger domain, C3HC4 0.0084
Further Details:      
 
Domain Number 2 Region: 2777-3003
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000111
Family Extended AAA-ATPase domain 0.039
Further Details:      
 
Domain Number 3 Region: 2420-2547,2589-2659
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000892
Family Extended AAA-ATPase domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002873
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.00144
Family NOB1 zinc finger-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002873   Gene: ENSMODG00000002357   Transcript: ENSMODT00000002930
Sequence length 5220
Comment pep:known_by_projection chromosome:BROADO5:2:235377156:235527268:-1 gene:ENSMODG00000002357 transcript:ENSMODT00000002930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCPSCHYISKDEAPKFCSDCGRNLVPAVNLQKNGESQLTMEAEIECGKELKGDDVLPLV
MDTSDHLPDKNKEAHPYNNYSDSSWTIQKSKKKNRKKKKKKDQRLLSEELDSLSLSHPVP
DSLTSVTNLGLMDKKIKPRESQVQEDGLMKPLVDYSDIQTGNNQISFPSVIESSNNNNVG
LESEEGVTKEKEISDLEAPVEKMEIDVHPEINQSVRILEEVNKMENCSPVDLVKIQGPTS
IAGKDIEQLKVKDNTWESLTELTSSKIEETDLLYSTPVQKVPLPDSKMDIPNQRKRKETS
KPQMNASPPREAKMKSTNQVTGSRKEDKNKNQELKQQLANEPASREVETQKKPTNQMERV
EDKNKPKDMKKQETPSESSVDSTSKNLGLSKEQKSQTANEKKLKNRTLNLGEGIRVYFHA
ILSVDFSFDPQCHKVSIRGGEDFGKNSWDHDVCEMNCTKNLSEHGFLIEGSMMITKDKMQ
KSIPYKYFIVHDSTEEYEFIYKVPFKPGQHVNRCLFIKDSGLSSGEWHQYDDIICKKPPK
NLIMKLKNFFTDETAKVVKGKYIAAKIMLENIFSIFSTWNTINLNSFFSQFSQFYFVVTK
PMVYEDQSKQWTSLGYGEKEMKNVLWKKMKCFILSSLSKKDDGGTFQPLKMGLIILILIE
TYKFPASEDDLISLCKLLCLDSISWTDLCEELKHLQGANLNLKNHLINMCQKCIEKEIFY
WVWILPILHYFVEFVDQKKDTRIQPQNTWAGLERLCISQFQKMVSKEKRILQYMKEKKHL
LTVDQKLFRSWFCLIPLSSVVDFLDNSLEYLTNCPASILDCLQGTYYHLQETDISFTNHE
ILENLFKKLLNLLNANQDKLQVDMLESYFPVCLKLHESVCKKTKMLRFYGLPVLSAEIIS
TMIRITLLGDPKDRKNHENANIISVEQLFQETLNTTKNWFRSILKEGLLQQYRRFLFYND
EPMAWSDFVKIDFTIEHLSKEWKKSLLSELEGRIKQEKPVHQIIVYCSCYDSLKNVDICV
AKTFETCAIEAVSPVCQSQTSIFDQLNSHNLRKFGTLVSAIITKSWPEKNGKKVDDLAEV
LQHLLTWTDIKHLFNLYGSDQKILEEITEDARKLMAIADSVFIRITCDLLSGKLLYSHMN
LIEKHKKQLLHLWKLKNNNLSPQEKEFDLEKVLSWRTCELQSLKRERKFVESLLKLCRKV
KEFVKVDFGDIEKKHLEDISGKRIDEVVTVGELHFSPVCEHKTYYNLNPWLLEMAKKVDS
LKDSYIFQVCWEEEAQSLGEHDDDSSVLILNLKNVYDVLYSPCHRRFLRLYKDLKSGELT
FAEVHSVFKNFVNKYDDLTRDLKIMCRLDANDKQDWISKRVEQIKEYHHLHLAVDSAKVI
CKVKDDLGLTGNFSVLQIFLSFTDEFNVAHEKLDRISSQLIQAKQLLQDIDETRRQCLEE
ISLRKEFIGWVKMALEDINELKVFVDLASISAGENDMDVDRVACFHDAVQGYASILYKLK
VGAGFNEFMEHLEELWKALENDQHLPKKLRDSARHLEWLKTVKDSHGSVELSSLSLATAI
NSKGIYVIRPPKDSQKVSLDTVLHLSLLEKHEDREEQRQYSLEELKELLNKLMLMSGKKD
QNNVEVDKFSEVFCNIQRLAQAFINLYSAGNVLFRSWTAMVYCSSKNPICIEMNFHLKAV
GKLTGKGEVTEVLAALCKQMELFLGNWKKFMIEKRSKYFYLNYYTAEQLVYLCIELKKQK
PSEAALAMLSFIKKNCTRYDVLKIFSTYFEGPSKHHMNQFSLCELQLVLFSESELMGKVK
VVWEFYMNYMSAFLPDCLDVDSLGICLACLSETGDTPTERHLPQGLQAGQPNLIICPNSD
VLSVALAVYMENPCQPLPTYDEVLLCTPLTTYEEVSLFLHRCLTLGYQGNKVYSLLYADE
LSYEVSCHVEELFQNLCVQRHREHYRLVIICNSDREHCYIPSVFSQYKVLMTPQQSLGDI
QAYLQSHYQVSYHTHSAASVFKDRVCVKVVTSKRAGVGKSLYVKRLHSKLKYENSGEEVP
LKTIRLIESQVNESKVLASLLPFLNVKYHKNPMLIHLDITSSVQTGIWEFLFKLLILQYL
MDTNGKMWLRHKCHLYVIEILEFTPTLLKRPSKVNAHGQQFSFLEIFPKVTCRPPKEVMC
MPLISSINEMEPRMDREEFCSESFQRPFQYLKRFHQGQNLDMFQYKPGSIEGTPEECLQQ
LLIHCGIMDPSWSELQNFSRFLNYQLRDCEASLFCNPAFIGDTLTGFKNFVVTFMILMAR
DFATPSLNISDQSSERQAFNMDGVNEEDIAPFCLRKKWESEPHPYIFFNDDHTSMTFIGF
HLQPNQNGGIDAISHLDGKVIKRNVMTQELYKGLLLQRVPFNINFDQLARSKKLEILCMV
LGIQWPMDPDETYELTTDNILKILAIEMRFRCGIPVLIMGETGCGKTRLIKFLTDLRRGG
VDAENMKLVKVHGGTSAATIYSKIREAEAIALFNRSQHQFDTVLFFDEANTTEAVSCIKE
VLCDNTVDGDPLIEDSGLHIIAACNPYRKHTQEMIKRLETAGLGYRVKADETVEKLGSIP
LRQLVYRVHALPPSMIPLVWDFGQLNNATERLYIQQIAQRLVHSMGITQKDIHVITEILS
ASQSYMRKRDNECSFVSLRDVERCVEVFKWFYGHSRLLLGKLNVFLQKSNANRSNFERDP
VLWSLVLAIGVCYHASLEEKEAYWEVICQLLRGPYSDIKTVLDEISQIQDLFLSGVPLRN
TIAKNLALKENIFMMVICIELRIPLFLVGKPGSSKSLAKTIVADAMQGQAAYNELFRELK
QVHLVSFQCSPHSTPQGIIGTFKQCARFQQGKNLQEYVSVVVLDEVGLAEDSPKMPLKAL
HPLLEDGCIDDDLLPHKKVGFIGISNWALDPAKMNRGIFVSRGSPNKKELIESAKGICCS
DTLIHDKIKDYFASFAEAYEVVCETQDKEFFGLRDYYSLIKMVFAVAKASNKEPTPQEIA
QAILRNFSGKDNIDALDTFTATLPEARFSEEVSTMDLIWQNIYGDSQTNQQADVECRYLL
VLTKNYVALQILQQAFFNENQQPEIIFGSSFPKDQEYTQICRNINRVKICMETGKMVVLL
NLQNLYESLYDALNQYYVYLGGQKYVDLGLGTHRVKCRVHPDFRLIVIEEKEVVYKQFPI
PLINRLEKHYLDINTVLEKWQKNIVKELQTWVTNFISVNADQAFAKHKYSPSEVFIGYHS
DTCASIVLQVTKSLRQQELTDEVYERVSDETKYVLLNCATPDAVVRLSSSKLGSFAAKTL
AQKYYCGQQHDSFLDFLQDHLQRMDSGCGTIFTEITTFSRLLTSHDCEMLETELHGLVQK
PKILWLQQFDTEYSFLKEIRNSLNITAGSKILIIQTDFEDDPKSSQLIASAKYSAVNEIN
NLLLEKGHIFVYFITKLSRMESGSSYVGFHGGLWHSVHIDDLRRPTIMVSDVTILQSVSI
SQLFKPEGLCEATQPTEMEVEPGTEADNEEDIEMETDIISSGEMEVENEKSEMEKGKEHA
EVLDTTSLLRSCVQSAMGMLKDQDNAFKRATRRVKILLSLLNEDDDMKASFLQVFKGRLF
SLLKKQEENYFYNVKQWVVREASNQNALQEAGTFRHTLWKRVQNAVIPLLAAVVSFIDRD
CNLELLVCPNSPPWVKALWMFIFRDLKFLNIPLMFNNTGLKAEMAPIMVQNYMKLSENVS
NDVPFSWRIKDYLDELWMEAQYITNTEELSEKFVDIFQKTHLGKFLASFNKEQHQMLLQA
YLKDFLLLTMSVSTCDELQFLQVALWSCIGQLKAESEDAEEGLSLPWVHLAYQYFRNRIQ
NFARILSIHPSVLETLQKAKNNFGLAGSEMVLDVYAALACAEMLKKDVLKPNPQVWLQMV
KNLHMPFEFLCTESYMQSCGAMCRTVLKEIKTQWNQIFSMALFVEHVLLETKARLPDLED
LVIEYVSLLGKCLQDNSDIKTHRPFVAVMAVLCKCKDRASQICIKYGLQPCPVCLGDPKE
PVCLPCDHVYCQKCIKTWLIPGQMRCPLCVTDLPDEFSIVVSQDHSDAIAKHIQFRQMCN
SFFIDLVSTMCFKENTPPDKEVIEELLSLLFVHKKLLRNELLSHSEYTKSLSPFDDVIDK
TPVIRSVVLKLLLKYSFHDVKEYIQDYLSQLEQKPFLDEDKTELYTLFINCLEDSMYEKV
SACSEKDGLCYLKEEGHFLGNYCPLLQNVREPVNESSVEYLQDMARIRLCLDRASDFLFE
LHEAVEVAEDKQRYLQQVKRFCLQAGNDWYRVYLVRKLVNQHGMEFVQSLCKQDHQSQWV
FPQEIINQMQDQSGQMDRYLVCGDNYKAIRDTVGKTVLKCDPKGVMTALKKCKISDTQQA
VYLLLAIFQEFTVSYRSSNVNIHPKPEQCEALNMLIKEAKVLSSPALKEMAKSLVTNVCP
SLTVHSHDSRHKSTVTELAVHTTAILLCGQNPVLEPLKNLAFNPANMQNSFLPTMPEDLL
AQAKNWQGLEEVQWYLCPNGHPCSVGECGAPMERSRCVDCGARIGGENHRPEQGFNVIRN
NVDRTQSGHVLGNPHDRGVMVVSDREISPVIFSLLRLLTHLAMLLGTAQNAQALMKIIKP
PVRDPESFLQQHIQKDLEQLMKSLGRSADETASVVHLILCCLIKEPHQQPSHWPVGFDAT
LSSKERRNNWEKVVAAMIICEMKCLDKTLIEANIRISQDERISSNPVAKIMYGDPATFLS
HLPKKSVVHCSKIWSYRKKITVEYLWHVVEQNDGKDFVPILYRFLQKERELRLVKFLPEI
LSLQRDLVKRFQNVSDVEYNTIRGFLISHYHSEGLKLSLQKQIEVFLSTWNKLRRSLYTS
GEIKLPKEYCDADLSLENEFEILLPRRRGLGLCSTALVSYLIALHNDLVYTVRKYTNESS
SYSVNSSEVTDLHVISYEVERDLTPLILSNCQYSVEKGRETLQQFDLEKIQRQVTSRFLQ
GKPLLTLQGLPTLVYRHDRNYEHIFMDIKNKMTQKSLPNSAISAISGQLQSYSDACEALS
VTEITLGFLSTAGGDPEMHLNVYIQDILQMHSQMDLVLKALSRCQLKHTIALWQFLSAHK
SEQLLRLRKDPFGEISAAYKEDLSAENAKLLNTFLNQSGLDTFLLELHEMIFLKLKHTET
EGENFNPKWSLKETLVSYMETKESEIPPEVEYQFPEEILLSHCIAVWKAAAGLKQDRRLT
Download sequence
Identical sequences F7GDM4
ENSMODP00000002873 XP_007482959.1.35504 ENSMODP00000002873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]