SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003570 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003570
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-30
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 398-502
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-23
Family Third domain of FERM 0.0061
Further Details:      
 
Domain Number 3 Region: 47-136
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000184
Family PDZ domain 0.023
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000621
Family Ubiquitin-related 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003570   Gene: ENSMODG00000002930   Transcript: ENSMODT00000003647
Sequence length 1573
Comment pep:known_by_projection chromosome:BROADO5:6:29425001:29559963:1 gene:ENSMODG00000002930 transcript:ENSMODT00000003647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLENNLLQTRKAHRLEQMVARWLRRSRDNSPRRRISLPDNSSGGLAQTLASAKHTLKI
DRDVFLGDYGFHISQSLPLSISSVITGSTADGKLLPGDQILRMNNQSVEDLSYEQALDIL
RETEDSLSITVTRCTSGAPKSSFLTEEKRARLKTNPVKVHFAEEVLVNGHSQGNALLCMP
NVLKVYLENGQTKAFKFEKNTTVKDIILTVKEKLSIRSIDHFALALEEQYNISKLHLLHE
EEFIDQVVQRKESHDYRCLFRLCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMRGKDIKKAISF
HMKRNQSLLEPRQKQLISAAQLRLNYLQILGELKTYGGKIFNATLMLQDRESYIALLVGA
KYGISQIINSKLNIMSTLAEFTNISRVELMEESEKVSMVKIYLQDVKLLTLLLESNSAKD
LACLISGYYRLFVDSAASVFLWGRNKQGHRISAEEGYESRACSDSEESSEVDSSLEFLSD
KHLMKMGHITPLCEEEEPEMLSEQKEGSITPTEAQKGACNGVGIPDLTSEGSDSANTESR
GCKTSGSSDSMDALEEDDLDACSSSRPDFFHFHTPDFQESFDENEPCPSLDSGKENSGFL
CLLGLSQRAAAELPNNELSNHASALKPSPGSEPSVPTVDPRLYDSSSMEYYSLCSNVSPA
SILSNSSESSSRNGPAQPGQEGKVWQAVPASVVVESLLFSPSPSFEDTSSDEEFYDADDK
LTPSDSLSDQSSVPFEEWSDPGSKGKKRESSEEGLAPRSHKREHNRRAGMKKYAKTLRKR
RSFLQTDYTSQVTFPLAPSCSLESVDHMCYYEREPYLSFVSHSPTVSSLQDMQGEPGLLE
TKALSLLPPPREAKSKNHSSNVMEMEPETMETKSVIDSFVSSISAVRLRIDPENKENSSM
SPSTSTPSSIPHHLSPGLFEQNGQSDPSEKAFQLRGGSGGLHQDQLVRPQSCPSKSSNAR
AGAKDGLTISPEEREGTPGIPGIGIKPQFEVGFRHLLENPIQETIQKCLEPLFSSGGLSR
NRECVKMSAEEVPFSAIKDQRGEQLLPPSFGDCQETGFSICDINQNSCSHFFQEEPRKDL
SEDSKSPENVPFEISDQRGEMAPLSKWQAFGAKTDQESPRQEEGRETALLVGRGPSCLPE
EQELLLSKKPLGTDAFNGHLSIPSGLQRFHEGQSDAEPREDRRRATVPPGVALLPHPDSC
STTHGSIFQADKGSLSIVPPSSKRPLLCFVHKSNPNISMNPSSDCSLDIAGMRDVILPQI
RMEPCSCQLSYATCFRGSGPEMDDDTSDLETTLSSAPLTTPPSSGSQSSVRRRPELPRSN
SCSGGEPHRRSSCLWPEYYAKMVNQLKAGLCRSPDGFCQLLDHVVELQDVLERFGGDGNR
HPQDRCAWCFSENRSSLCAGSQKLMSSCQHVIKIDQSPEEMQNAVQETFRNLIQLMGLCF
QFTNCGRCVRTHRDVMVNLKDVVCAYYQFVQAAKLACERGYRDLSVKLLARQCTALTAAV
FCLTQKFRASMAL
Download sequence
Identical sequences F6PMA2
ENSMODP00000003570 ENSMODP00000003570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]