SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004070 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004070
Domain Number 1 Region: 753-1033
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000706
Further Details:      
 
Domain Number 2 Region: 345-491
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-34
Family Third domain of FERM 0.00019
Further Details:      
 
Domain Number 3 Region: 242-347
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-32
Family Second domain of FERM 0.00023
Further Details:      
 
Domain Number 4 Region: 636-725
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-20
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 5 Region: 160-242
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-18
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004070   Gene: ENSMODG00000003330   Transcript: ENSMODT00000004156
Sequence length 1042
Comment pep:known_by_projection chromosome:BROADO5:6:32825293:33066588:-1 gene:ENSMODG00000003330 transcript:ENSMODT00000004156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTAFPYWNRSKRKGEGSQAFHLCLSRPSFPTLFPRLFPNPYLLERGWSRWRGPHTPSSR
PSPPLGGCENWEKWSGIACDAYSVTRGGTEHAQEPGQVRAVSRKPLAFLGHPPHLGRLLL
PDGPGYSTIVMNSRLRALGGRINNIRVSELPKEKTRSEIVCNLHFLDGLVQTFKVNKQDT
GQVLLDMAFNHLGITEKEYFGLQHGEDAMDSPRWLESSKPIRKQLKGPFPCTLNFRVRFF
IPDPNTLQQEQTRHLYFLQLKMDILEGRLICPLNSAVVLASYAVQSHFGDHNSSLHLSGY
LSDSQFIPDQNNDFVTKVETLHEQHSGLKQSEAESCFINIARTLEFYGVELHSGRDLHNL
DLMIGVAEGGIAVYRKHICTSFYPWVNILKISFKRKKFFIQQHQKHNEAREHIIAFNMLS
YRSCKNLWKSCVDHHTFFQAKKTIPRERNILAQYWTLGSKNPKKSLNNQYCKKVIGGMVW
NPTKRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLASETTYLTETE
DVFYTYKVSPSSKDSDSEYSQNRSPQRQNTLEDSPNSQTQTSSSSLSQFLNAPGCCSLDG
VDHQLLDSYTSVSKSCFTEDSNQYYCDKNEDGDGYLLLVCITPDEDGKFGFNLKGGVDQK
MPLVVSRISPESPADKCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELAL
LIRRKVVHSFAEVKSEDEINCQLFQDSILPMNLKYDNTLEESIEQLKEGIESGTVLIQFE
QLYRKKPGLAITYAKLSQNLDKNRYKDVLPYDCTRILLQGNEDYINASYVNMEIPSTKIV
NRYIATQGPLPHTCVHFWQAVWDHKLSLIIMLTTLTERGRTKCHQYWPNPPDVVEYGNFR
IKCQSEDCTIAYVFREMSVTKIETGEEHIVTHLQYVAWPDHGVPEDSSDFLEFVTYMRAL
RMENEPILVHCSAGIGRTGVLVTMETAMCLIERSQPVYPLDIIRKMRDQRAMMVQTSNQY
KFVCEAILRVYRDGLVQPLDSS
Download sequence
Identical sequences F7DD38
ENSMODP00000004070 ENSMODP00000004070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]