SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005178 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005178
Domain Number 1 Region: 596-802
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-33
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 2 Region: 805-990
Classification Level Classification E-value
Superfamily Fibronectin type III 3.43e-25
Family Fibronectin type III 0.0000259
Further Details:      
 
Domain Number 3 Region: 420-506
Classification Level Classification E-value
Superfamily Immunoglobulin 7.07e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 312-404
Classification Level Classification E-value
Superfamily Immunoglobulin 8.08e-20
Family I set domains 0.00068
Further Details:      
 
Domain Number 5 Region: 501-603
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-16
Family I set domains 0.037
Further Details:      
 
Domain Number 6 Region: 226-311
Classification Level Classification E-value
Superfamily Immunoglobulin 8.38e-16
Family I set domains 0.0018
Further Details:      
 
Domain Number 7 Region: 23-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000021
Family I set domains 0.0018
Further Details:      
 
Domain Number 8 Region: 124-204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000102
Family I set domains 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005178   Gene: ENSMODG00000004198   Transcript: ENSMODT00000005288
Sequence length 1028
Comment pep:known_by_projection chromosome:BROADO5:6:231649337:232144313:1 gene:ENSMODG00000004198 transcript:ENSMODT00000005288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRKLIILLPLISCYADSGILRGPNFTQEPQDLIYSLGVEDSEIILNCAANGYPVPDY
RWKQNGTDIDFTMSYHHRLVGGSLIISNPHIAEAIGIYQCLATNPLGTIVSRKAKLQFAY
IENFETKTRSTVSVLAGQGVVLFCGPPPYSGDVFYAWTYNDNPFPVQEASRRFISQATGN
LYIAKVEPSDVGNYTCIVTNMEAQKRVQGPPTPLVLRSDGVMGEYEPKIEVRFPEIMHAA
KGSTIKLECFALGNPVPDISWRKLDGSPLARKIQYSKSKGMIAIPNFQEEDEGSYECIAG
NLRGRNIARGQLFFYALPEWDKKIQNTDLSLYDSLLWECRASGSPIPSYTWLKNGEPIVP
EDRIHIENGSLMITVLNLSDSGFYQCVAENKYQTIYTNAELRVRASAPDFSKNPLQKISI
VQVGGNVTIECKPMASPRAMVSWKKGTEIIRQSKRFFILDDGSLNIYNVSKLDAGTYTCI
AKNQFGIAKASGNLVIKERTIITVPPPQMDVTVGESIVLPCQVFHDPSVEVVFTWSFNGQ
VIDFQRGVAHFERIGGESVGDLMIREIQLNHSGKYVCMVQTILDSLSAVADIIVRGPPGP
PNNLRIENISSTTSQLCWGPGVDNNSPIQIYTIQTRTPFSVGWLAVSTIPEILSGKMHTA
TVVGLNPWVEYEFRVVAGNSIGIGEPSKPSKLLRTKAAVPIVAPTNISGGGGSRSELVIT
WESIPEELQNGEGFGYIIMFRPVGSLMWTKASVASVETSKYVYRNESLTPLSPFEVKVGV
YNNEGEGTLSPATVVYTGEDEPQLAPTGASVQSYSSSEVDITWNAIAWNRSTGRVLGYEV
LYWTEDSKETSAGKIRVRGNVTTKIITGLKANTIYFATVRAYNTAGSGPSSAPVNITTKK
SPPSQAPSNIAWKLTNSKLCLNWEHVKTMENESDVLGYKILYRQDRQSKTHILETNNTSA
ELLVPFEEDYIIEIRTVSDGGDGSSSEKIRIPKMSSLSSGGMNVAEPRVNFLSAVIVIVD
CFTAMSLQ
Download sequence
Identical sequences F6Y8Y4
XP_007500167.1.35504 XP_007500168.1.35504 ENSMODP00000005178 ENSMODP00000005178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]