SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005827 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005827
Domain Number 1 Region: 3043-3201
Classification Level Classification E-value
Superfamily SET domain 9.16e-49
Family Histone lysine methyltransferases 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005827   Gene: ENSMODG00000004731   Transcript: ENSMODT00000005950
Sequence length 3201
Comment pep:novel chromosome:BROADO5:8:217167624:217221499:-1 gene:ENSMODG00000004731 transcript:ENSMODT00000005950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQKSKQQAKIEATQKLEQVKNEQQQQQQQQQQQFGSQSLVNQSGSDTPSSGIQSPLTPQ
PGNGSMSPAQSFHKDLFTKPQLPGPPTTAASDDVFLKPQAPPPPPPPAPVRIPVQEALPQ
TQTSPSPSSHMFSSGSSSSRPPSPVDPYAKMVGTPRPLPAGPNFPRRNSVGPVETCTTPL
SRSIQVTETTASRLSSARDVCSSSSASSDPYAKPPDTPRPVVTDQFSKPLGIPRSPIVME
QTGKGPLTAAGTNDPFTKPSPRPDRFQRQRMPDPYTRPPLTPAPVDSSTGPFKPPMHPPQ
PQQDPFGSVPQTPRRMSIDPYERPVLTPRPVDTFAHSQSSDPYSQPPHTPHPAMNDSFAH
PSRAFSQSGAMSRQTSQDPYSQPPGTPHPLADAFSQSSGTPRPIKDPYSQPSATARPTTI
DPYIQQSSTPMPSAQADLFVSSPGNQRHSDPYAHPPGTPRPAIPVPYSQGSALPRPGIPE
SFTRSPMTRPGLVPNQDTFLQATQNRGPTLSGTFVRSSDACSQTPRPPGPALSETFSHVP
PSPAHDPYDQPPMTPRPQSDSFGTSQISHDVVDQQRPGSEGNFNASSNSPMNSQGQQFST
VPQIPGPAPTLAVTDTQNTINMSPADTEKLRQRQKLREIILQQQQQKKNAIRQEKGLQDP
GSLQHWQPENLNPMFNRPPPPYPGNIRAPVVPPGGPRFPLFPKERGPFPSDVPGMGIRHH
GLRFGFPGGGHGPPSSQERFLVPPQQMQGPGVPPQLRRSMSVDMPRPLSNSQMNNPVGLT
PHFPPQGMQVQQHNILGQAFIELRHRVPDGRPRLPFNISANNVMEPTSQHHRHGNLIPRT
DFQGPRPTDPVRRTSQCIPSQTLVSTNLDHIPSSQQESGQTAHPSSLVMRSLSLPSGNDF
AGSSLPTPLSTDESSNLQMPSQPTDNLEEKLDPDDPSVKDLDVKDLEGVEVKDLDDEDLE
NLNLDPEDGKGDELDTLGNLETNDPNLDDLLRSGEFDIIAYTDPELDLGDKKSMFNEELD
LNVPIDDKLEMQCKTEEPKKDDKIDRNVISSDKLSPKKKSTIVNEIKTEVLSPHSQEEAK
SEKEKSENSTNTACTQLSTETELNEVEKASSISCDQDRIDNRTNQETVGLNTHVQGSTQM
PSQDVTSACSITESTPVLSSLLANEKSDNSDIQPLASPPPSLPDTQSNHVSSLPTTLIPP
SGPVLDHTMNSNMTVVSRMNHTFSQSVNVNPGFIHNQPANHSFGTGQSNNQAVSVANPSG
PSSMSGPQQLLLPQTLAQQNRERPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSE
PFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNMGMPPMVMNRFPFMSGTQSSEGQNLS
QQTIAQDGSLTPQISRPNPPNFGPGFVNDSQRKQYEEWLQDTQQLLQMQQKYLEEQIGLH
RKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKRLEQIRKQQKEHAELIEDY
RIKQQQQCAMAPPVLMPGVQPQPTMVPGGSPSTISQPNFPMASQQLQHQQHTSIIPSQSN
PARMPNLPGWQPTSTPPRLPVNASRIQPPMPPIPIKPNASAPGSTSNPNPQGGPPPIVEF
DDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRVLQQRIEMEQHGMIGSELNNRS
LSQIPYFNSDLPCDFMPHPRPLPPSPQHQQQIGQVLQQPGIQQGSVNSPPNQTFMQTNER
RHMGPAPFGPDPSLVPGGGPSFHSVKQPHGNLSGSNFSQGQIRPSFPPGMPTTPQTANSG
LPCGQETTVPHIQNYPGSSQSLIQLYSDIIPEEKGKKKRIRKKKKDDDAESTKAPSTPHS
DITAPPTPSISEPTSTPTMVTPSELNPHPIDPESSEPPGSSTTNEEINQPSSELEDNLSN
SGFSQRNPHHQSTEDSESVKFTLEVSKNIQEIKLEKAEAEQCPGQTEPKLEDQTGIKIEE
KVVLSASCPTQLVSVPPSKGDSGNELLKHLLKNKKTSSLLNKKSDDNLRLEEERSGNTKL
NEKHKSTEGLPIPGNQIQAGLGCGNNLLTKTDLLSETKKQRNKRTQRTGEKGAPRSKKRK
KDEEEKQSLYSNTETFAHLKQQLSLLPLMEPIIGVNFAHFLPYGSGQYNSGNRLLGAFGS
ATLEGVSDYYSQLIYKQNNLSNPPTPPASLPPTPPPVTCQKMANGFATTEELAGRAGMLV
GHDVTKALGPKQFPLPFKPQDDLLVRAMAQGPPKTVDVPASLPTPPHNNQEELRVQDPCN
DRDTPESFVPSSSPESVVGMEISRYPDLSLVKEEPPEPVPSPVIPILPSSTGKGSEARQN
DIKAEPGSGTLFFTSPFGPSPNGPKSGLISVAITLHPTAAENINSVVAAFSELLHVRIPN
SYEVSNTPDIPSHMALINGSRVNPGLEYRQQLLPHAPPPVSISHGRLVGSYKLKQPNMPF
PPTSNGLAGYKDHNQNIADNPALRPQWCCHCKVVILGSGVRKSFKGPGFLKQDSQESSDR
GEKDIVFCSNNCFVLYSTTVQGKTSEHKDSIPSLPHSPTKEMPPKAFHQYNTNISTLDVH
CLPQLQEKVSPPASPPITFPPALEAAKVEAKPDELKVTVKLKPRLRAIHSAFDDCRPLSK
KWKGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKRGTSLRPDPVPKDYRKCCFCHEEGD
GLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKMGA
TGGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGTHEQELSYFAVFRRVYVQRD
EVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSSKALFPVGYEASRLYWSTR
YANRRCRYLCSIEEKDGLPIFVIKIVEQGHEDLVLTDTSPKGVWDKILEPVACVRKESEM
LQLFPGYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAINPTGCAR
SEPKMSTHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWK
SNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRID
NDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDF
EDDQHKIPCHCGAVNCRKWMN
Download sequence
Identical sequences F6Y208
ENSMODP00000005827 ENSMODP00000005827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]