SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006768 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006768
Domain Number 1 Region: 11-137
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.63e-30
Family Hormone receptor domain 0.00018
Further Details:      
 
Domain Number 2 Region: 123-404
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000137
Family Rhodopsin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006768   Gene: ENSMODG00000005472   Transcript: ENSMODT00000006906
Sequence length 441
Comment pep:known_by_projection chromosome:BROADO5:8:226712088:226876977:-1 gene:ENSMODG00000005472 transcript:ENSMODT00000006906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRYPVLVPVLLTCWGLLPVSVNSIHPECRFHLEIHEEEVKCRDLLRAQTEYKACSGVWD
NITCWHPADIGETVTVPCPKAFSHFYNKPGNISKNCTSEGWSEMFPDFISACGYSDPEDD
NKITFYILVKAIYTLGYSVSLIALTTGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVL
VKDDILYSNSSTVHCPDQPSSWVGCKLSLVFFQYCIMANFYWLLVEGLYLHTLLMVIFSS
NRHFLIYLLIGWGIPTIFIVVWIVTRIFLEDSGCWDTNEHRIPWWVIRLPILISIIVNFF
LFISIIRILLQKLRSPDVGGNDQSQYKRLTKSTLLLIPLFGVHYMVFAVNPTGISTKYQI
LFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRGLCLNQSMSRDYRLHSSSISRNGSES
VLHFHRNSRAHSFLQTETTVI
Download sequence
Identical sequences F7CG94
XP_007504754.1.35504 ENSMODP00000006768 ENSMODP00000006768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]