SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007046 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007046
Domain Number 1 Region: 889-1175
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-69
Family Protein kinases, catalytic subunit 0.00000962
Further Details:      
 
Domain Number 2 Region: 588-893
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-45
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 437-538
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000152
Family SH2 domain 0.0066
Further Details:      
 
Domain Number 4 Region: 375-442
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000381
Family Third domain of FERM 0.017
Further Details:      
 
Domain Number 5 Region: 139-267
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000022
Family Second domain of FERM 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007046   Gene: ENSMODG00000005684   Transcript: ENSMODT00000007187
Sequence length 1197
Comment pep:known_by_projection chromosome:BROADO5:3:430991073:431000259:1 gene:ENSMODG00000005684 transcript:ENSMODT00000007187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLCHCAARHNDSDGDWVHPGSGLKVFLHWSNGGEQYVTYNQGTMTAEEVCIHIAKKVGI
TPLCYNLFALYDTQAQIWLPPNHLFEVTKDTNLTLQFRIRYYFRNWHGLNTQEPAVYRSM
TRNIEVSEDKIQMEQGCALLDKASFEYLFEQGKFEFVNDVASLWDLHSEAEIHHFKNESL
GMAVLHLSHLALQRGIPLEEVVRKTSFKDCIPRSFSRQIQQNNFLTKFRLRTVFQKFMRR
FHLQTVGPGHLSKQNIMFKYLATLEQLAPRFGAERFLALTLALPTEAERELCYVNSSGQT
PAGPAGSTFSLDAQVPTHEVLVMGTNGIRWRLLQEKVSTYVSELEINRPKSSFGKKSKAQ
KAENQKLSQLPTEKKDPSWTYFCDFQEITHVVVKESNVSIHRQDNKCLELTLPSPIVALS
LVSLIDGYFRLTADSSHYLCHEVAPPRLVMSIQNGIHGPLQESYVLSKLKREEVEDGLYL
IRWSSFDFHRLILTVARKDQAQGLRYKQFRIEEQGRTFQLEGWDQTFSSVRELTTALQGC
TLRSSSGSGPGSSLESFTISKCCLPRAGEISNLIITRHRPKEGPKPLNLSQLSFYQIRKD
EITQLAHLGQGTRTNIYEGLLHVGGGMEAEDEEEENIPSEPNNNHRELRVVLKVLDPSHR
DIALAFFETASLMSQVSHIHLAFVHGVCVRGSENIMVAEYVEHGPLDVCLRREKGHVPVA
WKITVAQQLASALSYLEDKNLVHGNVCAKNILLARRGLGDGTQPFIKLSDPGVSVTALSR
EERVERIPWIAPECVPSGTGLSTAADKWSFGTTLLEICFDGEAPLQGRTPSEKERFYEKK
HRLQEPSCKELATLISQCLTYEANQRPSFRTILRDLTQLQPQNLSDITTMSPEFPASDPT
VFQKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKSLKAGCSSQLLSSWQREIEI
LRTLYHDHIVKYKGCCSDQGEKIVQLIMEYVPLGSLRDYLPKHSLGLAQILLFAQQICKG
MSYLHSQHYIHRDLAARNVLLENDNIIKIGDFGLAKAVPEGRDYYCVREDGDSPVFWYAM
ECLKESKFYYASDVWSFGVTLYELLTRCDYNQSPPLKFIEMIGVTQGQMTVLRLIDLLER
GQRLPCPKDCPSEIYALMKSCWESEASFRPTFEKLDPILKTFHEKYRSQAPSVFSVC
Download sequence
Identical sequences F6V3I2
ENSMODP00000007046 ENSMODP00000007046 13616.ENSMODP00000007046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]