SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008550 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008550
Domain Number 1 Region: 62-239
Classification Level Classification E-value
Superfamily PR-1-like 6.28e-53
Family PR-1-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008550   Gene: ENSMODG00000006902   Transcript: ENSMODT00000008719
Sequence length 271
Comment pep:known_by_projection chromosome:BROADO5:3:161257485:161300589:-1 gene:ENSMODG00000006902 transcript:ENSMODT00000008719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVNPVASPLLHPKMIAVSAVSGVLLFSLLCETSAIALLNATDSSSPTNNFTDIEAALKAH
LDSADLPKTRRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAAT
CIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCYG
PMCTHYTQMVWATSNRIGCAIHTCQNMNVWGAVWRRAIYLVCNYAPKGNWIGEAPYKVGV
PCSACPPTYGGSCTDNLCFPGVTSNYLYWFK
Download sequence
Identical sequences F6PU70
ENSMODP00000008550 13616.ENSMODP00000008550 ENSMODP00000008550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]