SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008640 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008640
Domain Number 1 Region: 54-585
Classification Level Classification E-value
Superfamily Sema domain 9.03e-101
Family Sema domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1451-1575,1741-1922
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.61e-35
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 926-1007
Classification Level Classification E-value
Superfamily E set domains 0.000000000000177
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 4 Region: 1017-1106
Classification Level Classification E-value
Superfamily E set domains 0.000000000000853
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 5 Region: 1105-1185
Classification Level Classification E-value
Superfamily E set domains 0.0000000000014
Family E-set domains of sugar-utilizing enzymes 0.034
Further Details:      
 
Domain Number 6 Region: 588-640
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000379
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008640
Domain Number - Region: 748-791
Classification Level Classification E-value
Superfamily Plexin repeat 0.00392
Family Plexin repeat 0.0067
Further Details:      
 
Domain Number - Region: 1251-1298
Classification Level Classification E-value
Superfamily E set domains 0.00616
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008640   Gene: ENSMODG00000006963   Transcript: ENSMODT00000008811
Sequence length 1965
Comment pep:known_by_projection chromosome:BROADO5:6:246644252:246869331:-1 gene:ENSMODG00000006963 transcript:ENSMODT00000008811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLRCSSGGVWMAPPATGGAARSPRLLGVTTPLPLPLLLLLLTPLLAGSSALEIQRRFPSP
TPTNNFALDGPGGKVYLAAVNRLYQLSGPNLSLEVEEAVGPVRDNPLCHAPQLPQASCEH
PKMLTNNYNKILQLDPGQGLVVVCGSVYQGFCQLRRLGNISAVAVSFPPTADGAEPVAVF
PSMLNVAANHPNASTVGLVLEPPSGVLGGASPGGTRLLVGATYTGLGSQFFPPNQSLEDH
RFENTPEIAIRSLDTRGDLAKLFTFDLNPSDDNILKIKQGVKAQHKLGFVRAFLHPGSSG
APETPHGRDGPQMPANPAYAYLALNSEAKAGDKESQSHSLLARICLGWGPAGGPGGAAAE
TKKLTESYIQLKLHCGGQAGGEVFNRLVSVFPAAPGPSRPEDLLFGVFERAAPGGTGAAT
TRAQSALCVFRFRDIEGAIRAARNACFVDPSPDVVAVLESVVQGTGPACEKKRNIQLQPE
QLDCGAAHLQHPLSILQPLKATPVFRYQGLTSVAVASVNNYTVVFLGTANGRLLKINLNG
TMDMMSRKSITVAYGEAVHHIMQFDPIDPSYLYVMTSYQMARVKVAVCDQYTTCTDCLAA
EDAYCGWCAMETRCSLQHECANSTQPHFWTSASEGIQRCPSMTILPSEINIHKAYSGMII
QISGNMPSLSGMEMACDYGNGIHTVAKVPGQDFSHQIAFCNFLPRDKYPDFPSDQDHVTV
QTAVQVNGRNIVWANFTIYDCTRTGRVYPHTACTSCLSTRWPCFWCIQQHTCVSNVSECG
NTPNLTDSQGCPRILPMPLAPVPTGGLQNIHSSFSNCIFFQDLSLACNFGSDENFEATWV
NASEIQCSNVVLHTPQRSQIFPVNLQLKGKPDRFIDSPEKMTVEVYNCAMGSTDCSQCMG
REDLGHRCIWNEGCRLNQNPQPVTTTCPAPEIRKIEPLSGPLEGGTLLTIRGKNLGRRFS
EVAHSTWIGGVACEPLESRYIVSEEIVCWTGPSPSPFSDVITVNVSKEGKSRERYSYVLP
VVYSMEPDIGPKAGGTRVTIRGSDLGVGSELHVLVNDTKQCLNLVRTDSTITCTMPRGEL
LATVRVCVRFEHKSCIGGNITFDYMRDPIITAISPRRSPVSGGRTITVEGSRFDMVQNVS
MMVNYIGKEQTLCKVLNSTLITCPSPGATANKSAPVNFFINGQPYEDEQVAMEDPGEPKN
LLPSSRFSLEYLPDPQFSTAKREKWIKHHPGEPLTLVIHKEHDNLGLECREYQVKIGQTS
CEIQIVSDRVIHCSVNESLSTSEGHLPITIQVGNFNQTIATMQLGESETAITVSVVICSV
LLLLSIVGLFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELN
RSQGIPFLEYKHFVTRTFFPKCSSLYEERYILPSQPLNSQGGAQVQETHPLLLGEWKVMT
RFSPFQTEGIALFSTLLNNKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYT
SIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLLCA
IKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTL
TQVKEKILEAFCKNVPYSQWPRVEEVDLEWFASSTHSYILRDLDDTSVVEDGRKKLNTLA
HYKIPEGASLAMSLTDKKDATLSRVKDLDTEKYFHLVLPTDELIESKKSHKQSHRKKVLP
EIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAIKYFFDFLEEQAEKRGITDPDTLH
IWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTN
KLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLAEESRKYRNEFNTKVAMAEIYKY
AKRYRPQIMAALETNATTRRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences F6QUU6
ENSMODP00000008640 13616.ENSMODP00000008640 ENSMODP00000008640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]